BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_K08 (538 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 24 1.1 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 8.0 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 8.0 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 8.0 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.8 bits (49), Expect = 1.1 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +2 Query: 275 SEDGAPRSPQSSNRAHNPVSSVSHQALRP*PDDVVEHCLQTIS*DPSRRVST-VH 436 S +G+PRSP+S++R + P + + C T+ PS+ T VH Sbjct: 318 SNNGSPRSPESNSRCSVKREKIKISVSYPSTETLNTKC-NTLERTPSKCSQTSVH 371 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.0 bits (42), Expect = 8.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 75 QVLPLDATGPAAAERRLQ 128 +++ +D T P A ERR+Q Sbjct: 375 KMVQVDPTAPNAEERRVQ 392 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.0 bits (42), Expect = 8.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 75 QVLPLDATGPAAAERRLQ 128 +++ +D T P A ERR+Q Sbjct: 290 KMVQVDPTAPNAEERRVQ 307 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.0 bits (42), Expect = 8.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 75 QVLPLDATGPAAAERRLQ 128 +++ +D T P A ERR+Q Sbjct: 609 KMVQVDPTAPNAEERRVQ 626 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,842 Number of Sequences: 438 Number of extensions: 2296 Number of successful extensions: 51 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -