BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_K07 (430 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47415| Best HMM Match : No HMM Matches (HMM E-Value=.) 120 5e-28 SB_23958| Best HMM Match : FG-GAP (HMM E-Value=0.055) 35 0.025 SB_39015| Best HMM Match : Lectin_C (HMM E-Value=3.2e-28) 28 2.9 SB_382| Best HMM Match : Extensin_2 (HMM E-Value=0.61) 28 3.8 SB_9366| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_53762| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_30239| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_25851| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 27 6.6 SB_20270| Best HMM Match : Flavodoxin_1 (HMM E-Value=3.1e-35) 27 6.6 SB_11872| Best HMM Match : C1_2 (HMM E-Value=5.5) 27 6.6 SB_10311| Best HMM Match : S-antigen (HMM E-Value=0.73) 27 6.6 SB_3353| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_48755| Best HMM Match : 7tm_1 (HMM E-Value=1.6e-08) 27 8.7 SB_55360| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_47415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 120 bits (289), Expect = 5e-28 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 3/80 (3%) Frame = +1 Query: 199 PFADAIKS---SEDDVQDGLVHVRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKEFACN 369 PF DA K S VQ ++HVRIQQRNGRKTLTT+QG+S EYD KK+V+A KK+FACN Sbjct: 482 PFEDASKGDGESNTSVQRDVIHVRIQQRNGRKTLTTIQGISDEYDKKKLVKAFKKQFACN 541 Query: 370 GTVVEHPEYGEVLQLQGDQR 429 GTVV+HPEYGE +QLQGDQR Sbjct: 542 GTVVDHPEYGECIQLQGDQR 561 >SB_23958| Best HMM Match : FG-GAP (HMM E-Value=0.055) Length = 683 Score = 35.1 bits (77), Expect = 0.025 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = -1 Query: 337 RSSSSHIPRTSPAPWSMFYARSAAGFGRALDHLARRPPSF 218 R ++S P TS APW F+ GF R LD+L P F Sbjct: 320 RHATSSGPITSGAPWGSFHPDPKTGFIRILDNLVMTEPKF 359 >SB_39015| Best HMM Match : Lectin_C (HMM E-Value=3.2e-28) Length = 856 Score = 28.3 bits (60), Expect = 2.9 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = -3 Query: 425 WSPCSCSTSPYSGCSTTVPLHANSFLHARTIFFKSYSEDK 306 W P C YS C T+ + LH I SED+ Sbjct: 802 WRPFHCDDKFYSICKLTLRIERRQKLHYSNILLTVQSEDE 841 >SB_382| Best HMM Match : Extensin_2 (HMM E-Value=0.61) Length = 314 Score = 27.9 bits (59), Expect = 3.8 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 358 TPSCMPARSSSSHIPRTSPAP 296 +P MP R+SS +PR SP P Sbjct: 43 SPQPMPGRNSSPIVPRASPQP 63 >SB_9366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1221 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -1 Query: 409 AAPRRTPGAPQRYRCTRTPSCMPARSSSSHIPRTSPAPWS 290 A+P ++ +P ++ ++P P RS S+ P + P P S Sbjct: 411 ASPPQSVKSPIHFQANKSPPFHPQRSPSASKPSSRPPPLS 450 >SB_53762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 27.1 bits (57), Expect = 6.6 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 238 QDGLVHVRIQQRNGRKTLTTVQGLSS-EYDLKKIVRACKKEFACNG 372 QDGLV R+ Q NGR T + L YD +++ K+ G Sbjct: 760 QDGLVSYRVSQGNGRSDGTGLGDLRDVGYDGRRLAYGTKRGVLSGG 805 >SB_30239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 525 Score = 27.1 bits (57), Expect = 6.6 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -1 Query: 418 LAVAAPRRTPGAPQRYRCTRTPSCMPARSSSSHIPRTSPAP 296 +A+ PRR G Q +TPS PA S+ I ++ AP Sbjct: 355 IAMTVPRRHSGTYQFDLFPKTPSNKPAMSAEQWIMGSNKAP 395 >SB_25851| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 683 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 194 STHSPMLSKARRTTCKMV*CTSESSSGT 277 ++H PM S++++T C CT+E + T Sbjct: 565 TSHDPMTSQSKKTACGDNGCTTEETMDT 592 >SB_20270| Best HMM Match : Flavodoxin_1 (HMM E-Value=3.1e-35) Length = 724 Score = 27.1 bits (57), Expect = 6.6 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -1 Query: 364 TRTPSCMPA-RSSSSHIPRTSPAPWSM 287 T PSC P H+PR SP P+S+ Sbjct: 447 TAFPSCFPPFERLLEHLPRLSPRPYSI 473 >SB_11872| Best HMM Match : C1_2 (HMM E-Value=5.5) Length = 425 Score = 27.1 bits (57), Expect = 6.6 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = -1 Query: 412 VAAP-RRTPGAPQRYRCTRTPSCMPARSSSSHIPRTSPAPWSMFYARSAAGFGRALDHLA 236 +++P ++ PG YRC TP P R S+ + R + ++ ++ A + Sbjct: 201 ISSPVKKPPGFISMYRCILTPPGSPKRLSAVLVARKRSSNRTVASSKQARQHISSHSSPG 260 Query: 235 RRPPS 221 R PPS Sbjct: 261 RTPPS 265 >SB_10311| Best HMM Match : S-antigen (HMM E-Value=0.73) Length = 617 Score = 27.1 bits (57), Expect = 6.6 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = -1 Query: 427 AGRLAVAAPRRTPGAPQR----YRCTRTPSCMPARSSSSHIPRTSPAP 296 A + A A +T G P + ++C+ PA ++ P TSPAP Sbjct: 403 AAKTASPAAAKTSGPPAKSASNHKCSPAKPSTPASKDAAAKPPTSPAP 450 >SB_3353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 194 STHSPMLSKARRTTCKMV*CTSESSSGT 277 ++H PM S++++T C CT+E + T Sbjct: 202 TSHDPMTSQSKKTACGDNGCTTEETMDT 229 >SB_48755| Best HMM Match : 7tm_1 (HMM E-Value=1.6e-08) Length = 421 Score = 26.6 bits (56), Expect = 8.7 Identities = 9/39 (23%), Positives = 21/39 (53%) Frame = +3 Query: 90 LSVTVILLKCVVSQRFIETKSIYVQSYVHPESEHIRPIR 206 +S+T+++L V+ + S+ V Y+H + P++ Sbjct: 210 ISITILVLNYVIPVMILTVMSVRVLKYLHRRRQQAHPLQ 248 >SB_55360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 349 KKEFACNGTVVEHPEYGEVLQLQ 417 KK NGTV+ P YGE+ +++ Sbjct: 547 KKHIGLNGTVISLPIYGEMKEIR 569 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,101,507 Number of Sequences: 59808 Number of extensions: 312140 Number of successful extensions: 1051 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 992 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1050 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 826502419 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -