BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_K05 (480 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL... 202 5e-54 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 5.4 >Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL10 protein. Length = 204 Score = 202 bits (493), Expect = 5e-54 Identities = 93/148 (62%), Positives = 108/148 (72%) Frame = +1 Query: 37 MGAYRYIQELYRKKLSDVMRFLLRIRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQGYV 216 MGAYRY+QELYRKK SDVMR+LLR+R WQYRQ+TR HRAPRP RP + RRLGY+AK G+ Sbjct: 1 MGAYRYVQELYRKKQSDVMRYLLRVRAWQYRQMTRFHRAPRPWRPTRLRRLGYKAKTGFS 60 Query: 217 IFRIXXXXXXXXXXXXXXATYGKPKSHGVNQLKPTRNLQSIAEEXXXXXXXXXXXXNSYW 396 IFRI TYGKPKSHGVNQLKP R LQS+AEE NSYW Sbjct: 61 IFRIRVRCGGRKRPVHKGCTYGKPKSHGVNQLKPYRCLQSVAEERVGGRLGGLRVLNSYW 120 Query: 397 VAQDSSYKYFEVILIDPSHKAIRRDPKI 480 VAQD+++KYFEVI++DP + AIRRDP + Sbjct: 121 VAQDAAHKYFEVIMVDPPNNAIRRDPNV 148 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 24 QTRQDGRVQIYTGVV*EKVERC 89 Q +GR Q GV EK +RC Sbjct: 408 QCNAEGRCQCKPGVTGEKCDRC 429 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 503,071 Number of Sequences: 2352 Number of extensions: 9049 Number of successful extensions: 43 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 41863041 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -