BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_K01 (636 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) 231 5e-61 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_41410| Best HMM Match : 7tm_1 (HMM E-Value=0.00049) 29 3.2 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_17157| Best HMM Match : Kinesin (HMM E-Value=0.59) 27 9.7 >SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) Length = 261 Score = 231 bits (564), Expect = 5e-61 Identities = 110/157 (70%), Positives = 129/157 (82%) Frame = +3 Query: 129 QLLDEYPKCFIVGADNVGSQQMQQIRISLRGHSIVLMGKNTMMRKAIKDHLETNPALEKL 308 Q LDEYPK F+VG DNVGS+QMQ IR SLRG VLMGKNTM+RKAI+ HLE NP LEKL Sbjct: 1 QYLDEYPKLFLVGVDNVGSKQMQTIRQSLRGQGEVLMGKNTMIRKAIRGHLENNPDLEKL 60 Query: 309 LPHIKGNVGFVFTRGDLVDVRDKLLENKVQAPARPGAIAPLSVVIPAHNTGLGPEKTSFF 488 LPHIKGN+GFVFT+ DL DVR ++ENKV APA+ G IAP+ V +PA NTGLGPEKTSFF Sbjct: 61 LPHIKGNIGFVFTKEDLADVRKIIMENKVAAPAKAGVIAPIDVFVPAGNTGLGPEKTSFF 120 Query: 489 QALSIPTKISKGTIEIISDVHILKPGDKVGASEATSS 599 QAL+IPTKI++GTIEII+DVH++K +K+ A A S Sbjct: 121 QALAIPTKIARGTIEIINDVHLIKKDEKLKAFLADPS 157 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Frame = +3 Query: 384 ENKVQAPARPGAIAPLSVVIPAHN--TGLGPEKTSFFQALSIPTKISKGTIEIISDVHIL 557 E ++ +PA +P S+ TGL P S Q LS+ T + ++ +D+ Sbjct: 2069 EPRIVSPAGSSLASPTSIATSVITGVTGLHPVTVSHHQPLSVITSLVSASVSSTTDMQNS 2128 Query: 558 KPGDK 572 PG K Sbjct: 2129 TPGKK 2133 >SB_41410| Best HMM Match : 7tm_1 (HMM E-Value=0.00049) Length = 780 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -2 Query: 110 IGLPGSLVLPTHLGLSEVGTSEKFKDKTNTHRPLPR 3 IG+ +L LP + T KF +K N RP PR Sbjct: 331 IGIHDNLCLPRKSWIYRYRTVTKFNNKANVERPSPR 366 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 200 DPYFIAWSQHCAHGQKHHDEESHQGPS*NKSSSRKTASS 316 D Y QH H Q HD ++H+ + +++++R A S Sbjct: 144 DQYTTQPDQHMTHNQIDHDTQTHRPTTRSQTNTRHAARS 182 >SB_17157| Best HMM Match : Kinesin (HMM E-Value=0.59) Length = 2053 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 577 PTLSPGFRIWTSLIISIVPFEILVGMERAWKKEVFSGPR 461 P P FR +L+ ++ ++ M RAW+KEV S R Sbjct: 1843 PRNVPNFRACCALVSALSGYQY---MRRAWRKEVISSQR 1878 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,891,625 Number of Sequences: 59808 Number of extensions: 484111 Number of successful extensions: 1228 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1226 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -