BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_J23 (576 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 26 0.26 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 25 0.35 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 23 2.5 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 23 2.5 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 4.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 5.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 5.7 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 5.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.5 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 25.8 bits (54), Expect = 0.26 Identities = 19/54 (35%), Positives = 23/54 (42%) Frame = +2 Query: 320 LTGLLPAVLPDACVRCTDADKPHAIGDVYQLKVPNKQADIVVSFETTQSNEQSY 481 L +LP L +C +CTD K A V Q NKQ D E E +Y Sbjct: 62 LKRVLPDALKTSCAKCTDKQKQGA-KTVIQHLYKNKQ-DWWKQLEAKYDPEHTY 113 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 25.4 bits (53), Expect = 0.35 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = +2 Query: 278 HQACDLARGYA---ALALTGLLPAVLPDACVRCTDADKPHAIGDVYQLK 415 + AC L++G + L +LP L C +CT+ + A + +LK Sbjct: 43 YAACLLSKGPCPPQGVDLKRVLPEALQTNCAKCTEKQRTAAYRSIKRLK 91 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.6 bits (46), Expect = 2.5 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -3 Query: 421 WHFELINVSDGVRL 380 W +E +NV+DG++L Sbjct: 238 WAYEKLNVNDGLQL 251 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 22.6 bits (46), Expect = 2.5 Identities = 7/26 (26%), Positives = 18/26 (69%) Frame = -3 Query: 568 SREVNLNVCDLLALQVIH*LCDKWHY 491 ++++ L + LA+ +++ +CD+ HY Sbjct: 316 TKDIGLTINAGLAIFILYFICDEAHY 341 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.8 bits (44), Expect = 4.3 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 Query: 240 STRCPEQTPLRTCTRPVTWREDTRRWPSRD 329 +T CPEQ T T V + T W + + Sbjct: 124 TTNCPEQKNTVTVTFTVQSDDTTLNWGTNE 153 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 108 WTLGQLRARLYALPNSLSDVQIFPLGSLKSSYG 10 W L + + SD+Q+F G + + YG Sbjct: 922 WNLLPIAVFILVCATCSSDIQLFFAGLISAIYG 954 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 108 WTLGQLRARLYALPNSLSDVQIFPLGSLKSSYG 10 W L + + SD+Q+F G + + YG Sbjct: 922 WNLLPIAVFILVCATCSSDIQLFFAGLISAIYG 954 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.4 bits (43), Expect = 5.7 Identities = 12/43 (27%), Positives = 15/43 (34%) Frame = +2 Query: 59 SEFGNAYSLARSCPKVQTPEHSHHQMHAALPPACEQVFGGISP 187 S F N+Y V + EH H H Q G + P Sbjct: 3 SYFANSYMPDMRNGGVVSAEHPHQHQHYGAAVQVPQGGGAVQP 45 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/21 (33%), Positives = 10/21 (47%) Frame = +3 Query: 258 QTPLRTCTRPVTWREDTRRWP 320 Q L+ C + W +D WP Sbjct: 2259 QLQLQVCPNGLFWNKDHCDWP 2279 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,421 Number of Sequences: 336 Number of extensions: 2771 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14308417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -