BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_J23 (576 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 25 2.3 EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle... 24 3.1 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 24 4.1 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 24 4.1 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 4.1 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 5.4 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 5.4 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 23 5.4 AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical prote... 23 7.1 AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosens... 23 7.1 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 7.1 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 23 7.1 AF026493-1|AAB81851.1| 112|Anopheles gambiae chitinase protein. 23 7.1 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 24.6 bits (51), Expect = 2.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -1 Query: 324 VRASAAYPLARSQAWCKSLAASVPDT 247 VR++ AY L Q W +SLAA + +T Sbjct: 224 VRSTNAYSLDEIQTWYESLAAIMWNT 249 >EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle protein protein. Length = 178 Score = 24.2 bits (50), Expect = 3.1 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 373 VGAAHASVRQHSRQQSREG 317 V +AH+SVR HS + S +G Sbjct: 59 VDSAHSSVRVHSSRLSNDG 77 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 23.8 bits (49), Expect = 4.1 Identities = 18/53 (33%), Positives = 21/53 (39%) Frame = +3 Query: 6 RSHTMTSDYLTERSAHLRVNLATHIAWRAAVLKSRLPSTPTTRCTLLCHQPVN 164 R T T TE R TH R A ++ P P T + CH PVN Sbjct: 304 RFTTRTPATSTEHRYTTRTPTTTH---RLAA-RTSTPPDPETTSSQQCHPPVN 352 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 23.8 bits (49), Expect = 4.1 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 359 VRCTDADKPHAIGD 400 +RC D PH IGD Sbjct: 591 IRCGKCDGPHVIGD 604 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.8 bits (49), Expect = 4.1 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 228 LNGVISNNRLIGRSGEIPPNTCS 160 +NG IS+ L+ R +P +CS Sbjct: 964 VNGKISHGELLHRMNRVPSPSCS 986 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.4 bits (48), Expect = 5.4 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 Query: 107 QTPEHSHHQMHAALPPA 157 Q P H HHQ H P+ Sbjct: 102 QLPHHPHHQHHPQQQPS 118 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.4 bits (48), Expect = 5.4 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 Query: 107 QTPEHSHHQMHAALPPA 157 Q P H HHQ H P+ Sbjct: 102 QLPHHPHHQHHPQQQPS 118 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.4 bits (48), Expect = 5.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 88 AQLS*SPDSRALPPPDARCSATS 156 A+L S S ++PPP CS+ S Sbjct: 447 AKLPISCSSNSIPPPSNHCSSPS 469 >AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical protein protein. Length = 191 Score = 23.0 bits (47), Expect = 7.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +2 Query: 320 LTGLLPAVLPDACVRCTDADKPHAIGDVYQL 412 L +LP L C RC+ K +A+ + +L Sbjct: 67 LKRILPEALRTKCARCSPIQKENALKIITRL 97 >AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosensory protein CSP5 protein. Length = 191 Score = 23.0 bits (47), Expect = 7.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +2 Query: 320 LTGLLPAVLPDACVRCTDADKPHAIGDVYQL 412 L +LP L C RC+ K +A+ + +L Sbjct: 67 LKRILPEALRTKCARCSPIQKENALKIITRL 97 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.0 bits (47), Expect = 7.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -3 Query: 406 INVSDGVRLVRVGAAHASVRQHSRQQSREGQ 314 I DG R R G A+ +QH +QQ Q Sbjct: 289 IRSGDGGRDSRGGGVDAAKKQHQQQQRSSPQ 319 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 23.0 bits (47), Expect = 7.1 Identities = 15/56 (26%), Positives = 24/56 (42%) Frame = +2 Query: 191 RPISLLLDITPFRQACIHAVSGTDAAKDLHQACDLARGYAALALTGLLPAVLPDAC 358 R +S +L + A +H V G +A K + C L G ++ G L + C Sbjct: 3 RGLSAVLILLISLSAQLHVVVGEEAPKPEKEICGLKVGRLLDSVKGWLSVSQQEKC 58 >AF026493-1|AAB81851.1| 112|Anopheles gambiae chitinase protein. Length = 112 Score = 23.0 bits (47), Expect = 7.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 51 HLRVNLATHIAWRAAVL 101 H+R +L THI + AVL Sbjct: 15 HIRTDLCTHIVYGFAVL 31 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 614,792 Number of Sequences: 2352 Number of extensions: 11927 Number of successful extensions: 44 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -