BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_J23 (576 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U33058-1|AAB00542.1| 6632|Caenorhabditis elegans UNC-89 protein. 29 3.1 AF003131-5|AAV34799.1| 5992|Caenorhabditis elegans Uncoordinated... 29 3.1 AF003131-4|AAB54132.2| 6632|Caenorhabditis elegans Uncoordinated... 29 3.1 AF003131-3|AAV34801.1| 7122|Caenorhabditis elegans Uncoordinated... 29 3.1 AF003131-2|AAV34800.1| 7441|Caenorhabditis elegans Uncoordinated... 29 3.1 AF003131-1|AAP68958.1| 8081|Caenorhabditis elegans Uncoordinated... 29 3.1 U97593-7|AAB52878.1| 591|Caenorhabditis elegans Prion-like-(q/n... 27 9.5 U97593-6|AAB52879.2| 925|Caenorhabditis elegans Prion-like-(q/n... 27 9.5 U97593-5|AAB52880.1| 1175|Caenorhabditis elegans Prion-like-(q/n... 27 9.5 >U33058-1|AAB00542.1| 6632|Caenorhabditis elegans UNC-89 protein. Length = 6632 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +2 Query: 404 YQLKVPNKQADIVVSFETTQSNEQSYKDLVMPLITQLVDNLKSK 535 Y L++PN Q + ++ SN+ D L +L D+ K K Sbjct: 4354 YSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDK 4397 >AF003131-5|AAV34799.1| 5992|Caenorhabditis elegans Uncoordinated protein 89, isoform e protein. Length = 5992 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +2 Query: 404 YQLKVPNKQADIVVSFETTQSNEQSYKDLVMPLITQLVDNLKSK 535 Y L++PN Q + ++ SN+ D L +L D+ K K Sbjct: 3714 YSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDK 3757 >AF003131-4|AAB54132.2| 6632|Caenorhabditis elegans Uncoordinated protein 89, isoform a protein. Length = 6632 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +2 Query: 404 YQLKVPNKQADIVVSFETTQSNEQSYKDLVMPLITQLVDNLKSK 535 Y L++PN Q + ++ SN+ D L +L D+ K K Sbjct: 4354 YSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDK 4397 >AF003131-3|AAV34801.1| 7122|Caenorhabditis elegans Uncoordinated protein 89, isoform g protein. Length = 7122 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +2 Query: 404 YQLKVPNKQADIVVSFETTQSNEQSYKDLVMPLITQLVDNLKSK 535 Y L++PN Q + ++ SN+ D L +L D+ K K Sbjct: 4354 YSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDK 4397 >AF003131-2|AAV34800.1| 7441|Caenorhabditis elegans Uncoordinated protein 89, isoform f protein. Length = 7441 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +2 Query: 404 YQLKVPNKQADIVVSFETTQSNEQSYKDLVMPLITQLVDNLKSK 535 Y L++PN Q + ++ SN+ D L +L D+ K K Sbjct: 3714 YSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDK 3757 >AF003131-1|AAP68958.1| 8081|Caenorhabditis elegans Uncoordinated protein 89, isoform b protein. Length = 8081 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +2 Query: 404 YQLKVPNKQADIVVSFETTQSNEQSYKDLVMPLITQLVDNLKSK 535 Y L++PN Q + ++ SN+ D L +L D+ K K Sbjct: 4354 YSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDK 4397 >U97593-7|AAB52878.1| 591|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 22, isoform b protein. Length = 591 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/64 (25%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = +2 Query: 299 RGYAALALTGLLPAVLPDACVRCTDADKPHAIGDVYQLKVP-NKQADIVVSFETTQSNEQ 475 R Y T +P++ P V D + DV+ K N+ + F T + E Sbjct: 464 RNYEEKTETTTVPSLAPATNVTYKDLSNAQCVDDVFNKKTEMNESLPVGSVFNTHNNTEG 523 Query: 476 SYKD 487 Y+D Sbjct: 524 GYRD 527 >U97593-6|AAB52879.2| 925|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 22, isoform c protein. Length = 925 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/64 (25%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = +2 Query: 299 RGYAALALTGLLPAVLPDACVRCTDADKPHAIGDVYQLKVP-NKQADIVVSFETTQSNEQ 475 R Y T +P++ P V D + DV+ K N+ + F T + E Sbjct: 798 RNYEEKTETTTVPSLAPATNVTYKDLSNAQCVDDVFNKKTEMNESLPVGSVFNTHNNTEG 857 Query: 476 SYKD 487 Y+D Sbjct: 858 GYRD 861 >U97593-5|AAB52880.1| 1175|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 22, isoform a protein. Length = 1175 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/64 (25%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = +2 Query: 299 RGYAALALTGLLPAVLPDACVRCTDADKPHAIGDVYQLKVP-NKQADIVVSFETTQSNEQ 475 R Y T +P++ P V D + DV+ K N+ + F T + E Sbjct: 1048 RNYEEKTETTTVPSLAPATNVTYKDLSNAQCVDDVFNKKTEMNESLPVGSVFNTHNNTEG 1107 Query: 476 SYKD 487 Y+D Sbjct: 1108 GYRD 1111 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,242,712 Number of Sequences: 27780 Number of extensions: 276012 Number of successful extensions: 748 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 748 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1194789454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -