BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_J22 (587 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46389| Best HMM Match : No HMM Matches (HMM E-Value=.) 215 2e-56 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_3680| Best HMM Match : Keratin_B2 (HMM E-Value=0.0024) 30 1.6 SB_37323| Best HMM Match : RTBV_P12 (HMM E-Value=2.3) 29 2.1 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 29 2.1 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 29 2.1 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 29 2.8 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_3451| Best HMM Match : HOK_GEF (HMM E-Value=9.4) 29 2.8 SB_46293| Best HMM Match : Keratin_B2 (HMM E-Value=0.00077) 29 2.8 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 28 4.9 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 28 4.9 SB_13929| Best HMM Match : VKOR (HMM E-Value=0.65) 28 4.9 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 28 4.9 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 28 6.5 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 28 6.5 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 27 8.6 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 27 8.6 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 27 8.6 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_46389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 215 bits (525), Expect = 2e-56 Identities = 97/161 (60%), Positives = 118/161 (73%) Frame = +2 Query: 104 MGAYRYIQELYRKKLSDVMRFLLRIRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQGYV 283 MGAY+Y++ELY+KK SD++RFLLR+R WQYRQLT +HRA RPTRPDKARRLGY+AKQG+V Sbjct: 1 MGAYKYLEELYKKKQSDLLRFLLRVRCWQYRQLTAIHRATRPTRPDKARRLGYKAKQGFV 60 Query: 284 IFRIXXXXXXXXXXXXXXATYGKPKSHGVNQLKPTRNLQSIAEEXXXXXXXXXXXXNSYW 463 I+R+ ATYGKP + GVN+LK R+L+S+AEE NSYW Sbjct: 61 IYRVRVRRGGRKRPVPKGATYGKPVNQGVNELKFQRSLRSVAEERAGRYCGGLRVLNSYW 120 Query: 464 VAQDSSYKYFEVILIDPSHNAIRRDPKINWIVNAVHKHREM 586 V QDS YKYFEVI++DP H AIRRD +INWI HKHRE+ Sbjct: 121 VGQDSIYKYFEVIMVDPFHKAIRRDARINWICKPTHKHREL 161 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.7 bits (66), Expect = 0.92 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -1 Query: 80 QPRADSCSPGIH-CSRAPPPRWS 15 +PR++SCSPG PPPRWS Sbjct: 20 RPRSNSCSPGDPLVLERPPPRWS 42 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 30.7 bits (66), Expect = 0.92 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = -1 Query: 128 PVYICTRPS*RVCDRLQP--RADSCSPGIH-CSRAPPPRWS 15 P +C+R RLQ R++SCSPG PPPRWS Sbjct: 46 PKRLCSREFCASLSRLQRQGRSNSCSPGDPLVLERPPPRWS 86 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 0.92 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -1 Query: 80 QPRADSCSPGIH-CSRAPPPRWS 15 +PR++SCSPG PPPRWS Sbjct: 15 RPRSNSCSPGDPLVLERPPPRWS 37 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 77 PRADSCSPGIH-CSRAPPPRWS 15 PR++SCSPG PPPRWS Sbjct: 2 PRSNSCSPGDPLVLERPPPRWS 23 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 77 PRADSCSPGIH-CSRAPPPRWS 15 PR++SCSPG PPPRWS Sbjct: 68 PRSNSCSPGDPLVLERPPPRWS 89 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -1 Query: 152 RSTFSYTTPVYICTRPS*RVCDRLQPRADSCSPGIH-CSRAPPPRWS 15 ++ F + P + + P R+ L+P ++SCSPG PPPRWS Sbjct: 39 KNGFPASPPHFRASSPW-RLPGNLRPVSNSCSPGDPLVLERPPPRWS 84 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -1 Query: 86 RLQPRADSCSPGIH-CSRAPPPRWS 15 R +P+++SCSPG PPPRWS Sbjct: 27 RRKPQSNSCSPGDPLVLERPPPRWS 51 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 83 LQPRADSCSPGIH-CSRAPPPRWS 15 +QP ++SCSPG PPPRWS Sbjct: 61 VQPLSNSCSPGDPLVLERPPPRWS 84 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -1 Query: 98 RVCDRLQPRADSCSPGIH-CSRAPPPRWS 15 RV + R++SCSPG PPPRWS Sbjct: 21 RVASLCRSRSNSCSPGDPLVLERPPPRWS 49 >SB_3680| Best HMM Match : Keratin_B2 (HMM E-Value=0.0024) Length = 180 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/68 (25%), Positives = 29/68 (42%), Gaps = 4/68 (5%) Frame = +1 Query: 199 VDSYAPRSQAHEARQGEKAWI---PCQARLCYLQNPRAPWW-P*TPSAQGSYLRQTQEPW 366 V Y ++ ++A + + W QA C+ ++ W+ P Y TQ Sbjct: 17 VPPYKTKANLNQASKTQANWCHPYKTQANWCHTSKIQSNWYHPNKTQTNWCYPTNTQANL 76 Query: 367 CQPTETHS 390 C PT+TH+ Sbjct: 77 CHPTKTHA 84 >SB_37323| Best HMM Match : RTBV_P12 (HMM E-Value=2.3) Length = 225 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -2 Query: 112 RAHLDESVIDFSLVPIHAARGST 44 R LD+ + DFS+VP+ A+G T Sbjct: 23 RKRLDKEIFDFSVVPVKRAKGRT 45 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 92 CDRLQPRADSCSPGIH-CSRAPPPRWS 15 CD + ++SCSPG PPPRWS Sbjct: 46 CDYVNDISNSCSPGDPLVLERPPPRWS 72 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -1 Query: 131 TPVYICTRPS*RVCDRLQPRADSCSPGIH-CSRAPPPRWS 15 T V + T S + D ++SCSPG PPPRWS Sbjct: 92 TMVLMMTMVSRNIPDHYSSPSNSCSPGDPLVLERPPPRWS 131 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 80 QPRADSCSPGIH-CSRAPPPRWS 15 QP ++SCSPG PPPRWS Sbjct: 95 QPPSNSCSPGDPLVLERPPPRWS 117 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 86 RLQPRADSCSPGIH-CSRAPPPRWS 15 R+ R++SCSPG PPPRWS Sbjct: 377 RVDRRSNSCSPGDPLVLERPPPRWS 401 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 83 LQPRADSCSPGIH-CSRAPPPRWS 15 L+ R++SCSPG PPPRWS Sbjct: 21 LRSRSNSCSPGDPLVLERPPPRWS 44 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 83 LQPRADSCSPGIH-CSRAPPPRWS 15 L P ++SCSPG PPPRWS Sbjct: 18 LAPTSNSCSPGDPLVLERPPPRWS 41 >SB_3451| Best HMM Match : HOK_GEF (HMM E-Value=9.4) Length = 173 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 161 RFLLRIRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQ 274 +F ++ YR+ T+MH +RP + R G+R KQ Sbjct: 16 KFFVKRLTTPYRRRTQMHLLVSTSRPASSWRRGFRGKQ 53 >SB_46293| Best HMM Match : Keratin_B2 (HMM E-Value=0.00077) Length = 677 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/65 (24%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Frame = +1 Query: 208 YAPRSQAHEARQGEKAWI---PCQARLCYLQNPRAPWW-P*TPSAQGSYLRQTQEPWCQP 375 Y ++ ++A + + W QA C+ ++ W+ P Y TQ C P Sbjct: 175 YKTKANLNQASKTQANWCHPYKTQANWCHTSKIQSNWYHPNKTQTNWCYPTNTQANLCHP 234 Query: 376 TETHS 390 T+TH+ Sbjct: 235 TKTHA 239 >SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -1 Query: 98 RVCDRLQPRADSCSPGIH-CSRAPPPRWS 15 R +++Q ++SCSPG PPPRWS Sbjct: 39 RCLNKVQSLSNSCSPGDPLVLERPPPRWS 67 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 83 LQPRADSCSPGIH-CSRAPPPRWS 15 L P ++SCSPG PPPRWS Sbjct: 22 LSPGSNSCSPGDPLVLERPPPRWS 45 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 98 RVCDRLQPRADSCSPGIH-CSRAPPPRWS 15 R C R++SCSPG PPPRWS Sbjct: 46 RACTDKPFRSNSCSPGDPLVLERPPPRWS 74 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -1 Query: 86 RLQPRADSCSPGIH-CSRAPPPRWS 15 R Q ++SCSPG PPPRWS Sbjct: 4 RFQATSNSCSPGDPLVLERPPPRWS 28 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 83 LQPRADSCSPGIH-CSRAPPPRWS 15 L R++SCSPG PPPRWS Sbjct: 555 LSDRSNSCSPGDPLVLERPPPRWS 578 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -1 Query: 98 RVCDRLQPRADSCSPGIH-CSRAPPPRWS 15 RV + Q ++SCSPG PPPRWS Sbjct: 5 RVSIKQQATSNSCSPGDPLVLERPPPRWS 33 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 86 RLQPRADSCSPGIHCS-RAPPPRWS 15 RL+ ++SCSPG PPPRWS Sbjct: 148 RLEKISNSCSPGDPLVLERPPPRWS 172 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 83 LQPRADSCSPGIHCS-RAPPPRWS 15 L R++SCSPG PPPRWS Sbjct: 51 LHVRSNSCSPGDPLVLERPPPRWS 74 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 80 QPRADSCSPGIHCS-RAPPPRWS 15 +P ++SCSPG PPPRWS Sbjct: 45 KPTSNSCSPGDPLVLERPPPRWS 67 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 83 LQPRADSCSPGIHCS-RAPPPRWS 15 ++ R++SCSPG PPPRWS Sbjct: 21 VEKRSNSCSPGDPLVLERPPPRWS 44 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 83 LQPRADSCSPGIHCS-RAPPPRWS 15 LQ ++SCSPG PPPRWS Sbjct: 23 LQAASNSCSPGDPLVLERPPPRWS 46 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -1 Query: 95 VCDRLQPRADSCSPGIHCS-RAPPPRWS 15 V L R++SCSPG PPPRWS Sbjct: 52 VVGMLPRRSNSCSPGDPLVLERPPPRWS 79 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 80 QPRADSCSPGIHCS-RAPPPRWS 15 +P ++SCSPG PPPRWS Sbjct: 4 RPTSNSCSPGDPLVLERPPPRWS 26 >SB_13929| Best HMM Match : VKOR (HMM E-Value=0.65) Length = 498 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 337 SYLRQTQEPWCQPTETHSQPAVYC*GACWSPVWWS 441 S+LR T CQP+++ P + G C S WWS Sbjct: 343 SFLRGTSFNICQPSQSMLNPIKHEGGLC-STQWWS 376 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -1 Query: 98 RVCDRLQPRADSCSPGIHCS-RAPPPRWS 15 R+C + R++SCSPG PPPRWS Sbjct: 26 RIC---RERSNSCSPGDPLVLERPPPRWS 51 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -1 Query: 95 VCDRLQPRADSCSPGIHCS-RAPPPRWS 15 + + LQ ++SCSPG PPPRWS Sbjct: 655 ILNSLQLASNSCSPGDPLVLERPPPRWS 682 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 86 RLQPRADSCSPGIHCS-RAPPPRWS 15 ++ P ++SCSPG PPPRWS Sbjct: 26 KVYPVSNSCSPGDPLVLERPPPRWS 50 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 83 LQPRADSCSPGIHCS-RAPPPRWS 15 + R++SCSPG PPPRWS Sbjct: 7 MHTRSNSCSPGDPLVLERPPPRWS 30 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 77 PRADSCSPGIHCS-RAPPPRWS 15 P ++SCSPG PPPRWS Sbjct: 9 PASNSCSPGDPLVLERPPPRWS 30 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 77 PRADSCSPGIHCS-RAPPPRWS 15 P ++SCSPG PPPRWS Sbjct: 140 PSSNSCSPGDPLVLERPPPRWS 161 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 77 PRADSCSPGIHCS-RAPPPRWS 15 P ++SCSPG PPPRWS Sbjct: 15 PTSNSCSPGDPLVLERPPPRWS 36 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 98 RVCDRLQPRADSCSPGIHCS-RAPPPRWS 15 R R Q ++SCSPG PPPRWS Sbjct: 75 RGAKRQQMASNSCSPGDPLVLERPPPRWS 103 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 27.9 bits (59), Expect = 6.5 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 5/52 (9%) Frame = -1 Query: 155 HRSTFSYTTPVYICTRPS*RVCDRLQPR----ADSCSPGIHCS-RAPPPRWS 15 H TF+ T + ++PS + L P ++SCSPG PPPRWS Sbjct: 26 HHLTFTIRTHPTL-SKPSYTITTYLSPLEPILSNSCSPGDPLVLERPPPRWS 76 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 98 RVCDRLQPRADSCSPGIHCS-RAPPPRWS 15 R C + ++SCSPG PPPRWS Sbjct: 2 RPCVTMPRASNSCSPGDPLVLERPPPRWS 30 >SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 565 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +1 Query: 268 QARLCYLQNPRAPWW-P*TPSAQGSYLRQTQEPWCQPTETHS 390 QA + A W P T A Y +TQ WC PT+T + Sbjct: 293 QANCGHPTKTHANWCHPTTTHANWCYPTKTQANWCHPTKTQA 334 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 80 QPRADSCSPGIHCS-RAPPPRWS 15 +P ++SCSPG PPPRWS Sbjct: 38 KPPSNSCSPGDPLVLERPPPRWS 60 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 89 DRLQPRADSCSPGIHCS-RAPPPRWS 15 +R R++SCSPG PPPRWS Sbjct: 2 NRYYYRSNSCSPGDPLVLERPPPRWS 27 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -1 Query: 95 VCDRLQPRADSCSPGIHCS-RAPPPRWS 15 +CD ++SCSPG PPPRWS Sbjct: 18 ICDCHAHVSNSCSPGDPLVLERPPPRWS 45 >SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 83 LQPRADSCSPGIHCS-RAPPPRWS 15 L+ +++SCSPG PPPRWS Sbjct: 2 LKKKSNSCSPGDPLVLERPPPRWS 25 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 80 QPRADSCSPGIHCS-RAPPPRWS 15 +P ++SCSPG PPPRWS Sbjct: 10 RPGSNSCSPGDPLVLERPPPRWS 32 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 77 PRADSCSPGIHCS-RAPPPRWS 15 P ++SCSPG PPPRWS Sbjct: 18 PASNSCSPGDPLVLERPPPRWS 39 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 77 PRADSCSPGIHCS-RAPPPRWS 15 P ++SCSPG PPPRWS Sbjct: 182 PPSNSCSPGDPLVLERPPPRWS 203 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 77 PRADSCSPGIHCS-RAPPPRWS 15 P ++SCSPG PPPRWS Sbjct: 16 PPSNSCSPGDPLVLERPPPRWS 37 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 21 RSNSCSPGDPLVLERPPPRWS 41 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 10 RSNSCSPGDPLVLERPPPRWS 30 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 12 RSNSCSPGDPLVLERPPPRWS 32 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 16 RSNSCSPGDPLVLERPPPRWS 36 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 4 RSNSCSPGDPLVLERPPPRWS 24 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 13 RSNSCSPGDPLVLERPPPRWS 33 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 875 RSNSCSPGDPLVLERPPPRWS 895 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 77 PRADSCSPGIHCS-RAPPPRWS 15 P ++SCSPG PPPRWS Sbjct: 24 PGSNSCSPGDPLVLERPPPRWS 45 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 39 RSNSCSPGDPLVLERPPPRWS 59 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 4 RSNSCSPGDPLVLERPPPRWS 24 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 77 PRADSCSPGIHCS-RAPPPRWS 15 P ++SCSPG PPPRWS Sbjct: 16 PLSNSCSPGDPLVLERPPPRWS 37 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 63 RSNSCSPGDPLVLERPPPRWS 83 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 77 PRADSCSPGIHCS-RAPPPRWS 15 P ++SCSPG PPPRWS Sbjct: 19 PPSNSCSPGDPLVLERPPPRWS 40 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 16 RSNSCSPGDPLVLERPPPRWS 36 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 15 RSNSCSPGDPLVLERPPPRWS 35 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 8 RSNSCSPGDPLVLERPPPRWS 28 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 5 RSNSCSPGDPLVLERPPPRWS 25 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 26 RSNSCSPGDPLVLERPPPRWS 46 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 110 RSNSCSPGDPLVLERPPPRWS 130 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 31 RSNSCSPGDPLVLERPPPRWS 51 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 6 RSNSCSPGDPLVLERPPPRWS 26 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 8 RSNSCSPGDPLVLERPPPRWS 28 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 25 RSNSCSPGDPLVLERPPPRWS 45 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 92 RSNSCSPGDPLVLERPPPRWS 112 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 20 RSNSCSPGDPLVLERPPPRWS 40 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = -1 Query: 116 CTRPS*RVCD--RLQPRADSCSPGIHCS-RAPPPRWS 15 CT P C L P ++SCSPG PPPRWS Sbjct: 40 CTPPLLSPCTPPHLSP-SNSCSPGDPLVLERPPPRWS 75 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 64 RSNSCSPGDPLVLERPPPRWS 84 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 10 RSNSCSPGDPLVLERPPPRWS 30 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 29 RSNSCSPGDPLVLERPPPRWS 49 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 16 RSNSCSPGDPLVLERPPPRWS 36 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 83 LQPRADSCSPGIHCS-RAPPPRWS 15 + P ++SCSPG PPPRWS Sbjct: 56 IPPVSNSCSPGDPLVLERPPPRWS 79 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 44 RSNSCSPGDPLVLERPPPRWS 64 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 26 RSNSCSPGDPLVLERPPPRWS 46 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 11 RSNSCSPGDPLVLERPPPRWS 31 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 77 PRADSCSPGIHCS-RAPPPRWS 15 P ++SCSPG PPPRWS Sbjct: 138 PGSNSCSPGDPLVLERPPPRWS 159 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 17 RSNSCSPGDPLVLERPPPRWS 37 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 45 RSNSCSPGDPLVLERPPPRWS 65 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 322 RSNSCSPGDPLVLERPPPRWS 342 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 16 RSNSCSPGDPLVLERPPPRWS 36 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 25 RSNSCSPGDPLVLERPPPRWS 45 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 60 RSNSCSPGDPLVLERPPPRWS 80 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 5 RSNSCSPGDPLVLERPPPRWS 25 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 7 RSNSCSPGDPLVLERPPPRWS 27 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 14 RSNSCSPGDPLVLERPPPRWS 34 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 7 RSNSCSPGDPLVLERPPPRWS 27 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 8 RSNSCSPGDPLVLERPPPRWS 28 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 12 RSNSCSPGDPLVLERPPPRWS 32 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 77 PRADSCSPGIHCS-RAPPPRWS 15 P ++SCSPG PPPRWS Sbjct: 71 PPSNSCSPGDPLVLERPPPRWS 92 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 55 RSNSCSPGDPLVLERPPPRWS 75 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 14 RSNSCSPGDPLVLERPPPRWS 34 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 3 RSNSCSPGDPLVLERPPPRWS 23 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 214 RSNSCSPGDPLVLERPPPRWS 234 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 8 RSNSCSPGDPLVLERPPPRWS 28 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 19 RSNSCSPGDPLVLERPPPRWS 39 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 1 RSNSCSPGDPLVLERPPPRWS 21 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 5 RSNSCSPGDPLVLERPPPRWS 25 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 5 RSNSCSPGDPLVLERPPPRWS 25 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 35 RSNSCSPGDPLVLERPPPRWS 55 >SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 83 LQPRADSCSPGIHCS-RAPPPRWS 15 LQ ++SCSPG PPPRWS Sbjct: 26 LQGLSNSCSPGDPLVLERPPPRWS 49 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -1 Query: 74 RADSCSPGIHCS-RAPPPRWS 15 R++SCSPG PPPRWS Sbjct: 21 RSNSCSPGDPLVLERPPPRWS 41 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,297,082 Number of Sequences: 59808 Number of extensions: 404779 Number of successful extensions: 2544 Number of sequences better than 10.0: 119 Number of HSP's better than 10.0 without gapping: 2430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2518 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1422302661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -