BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_J18 (416 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41186| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.22 SB_47329| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 >SB_41186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.9 bits (69), Expect = 0.22 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +2 Query: 251 STRPEDHRRKWDKDEFXXXXXXXXXXXXXXXXXXXXXXXP-V*RELLRLREYKVDL 415 S + ++ RR WDK+E+ P V RELL+ R+Y+VDL Sbjct: 5 SGKSDNFRRTWDKEEYEKKAKDRLKEEEEGESSIEKRNGPPVKRELLKKRDYEVDL 60 >SB_47329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 432 Score = 27.5 bits (58), Expect = 4.7 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 192 SISGKLFSLYHLLKINIAS*VRGPKIIVGNGTKTNSK 302 S +G+LF H LK+N + R P I NGTK + + Sbjct: 270 SPTGELFPNLHTLKLNKTAIGRLPNITKLNGTKVDEE 306 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,470,894 Number of Sequences: 59808 Number of extensions: 121527 Number of successful extensions: 182 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 180 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -