BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_J15 (467 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 25 1.3 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 23 7.0 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 25.0 bits (52), Expect = 1.3 Identities = 14/40 (35%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 294 DGGKSHYTSRQHLQ--LIS*YCPIKKPSKSPQLCHEKKNV 407 D G YT + L S P+K PSK P L +N+ Sbjct: 574 DSGVDEYTQEKDRPNALASPASPLKSPSKIPGLARRPENI 613 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 22.6 bits (46), Expect = 7.0 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = +1 Query: 136 IQCLLNYLSCDNDFFVYKKTQEILQSFLNYLSKVTI 243 + LN ++ D D Y KT + + F N + I Sbjct: 343 VPSFLNIIATDEDPPTYNKTNKFTRGFQNLIESYGI 378 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 443,206 Number of Sequences: 2352 Number of extensions: 8525 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -