BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_J10 (434 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33983| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.033 SB_2161| Best HMM Match : Ribosomal_L22e (HMM E-Value=1.1e-05) 35 0.033 SB_2130| Best HMM Match : fn2 (HMM E-Value=2.7e-15) 31 0.41 SB_44986| Best HMM Match : Ion_trans_2 (HMM E-Value=6.9e-15) 30 0.72 SB_43215| Best HMM Match : ResIII (HMM E-Value=7.9) 30 0.95 SB_20002| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_55881| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_44112| Best HMM Match : PA14 (HMM E-Value=5e-05) 28 3.8 SB_28078| Best HMM Match : SGS (HMM E-Value=1.5) 28 3.8 SB_9898| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_34697| Best HMM Match : Ion_trans (HMM E-Value=7.9e-38) 28 3.8 SB_33294| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_3220| Best HMM Match : Ion_trans (HMM E-Value=5.6e-22) 27 5.0 SB_43676| Best HMM Match : Ion_trans (HMM E-Value=1.2e-39) 27 6.7 SB_8959| Best HMM Match : PAN (HMM E-Value=0.013) 27 6.7 SB_38850| Best HMM Match : ResIII (HMM E-Value=0.045) 27 8.8 SB_37320| Best HMM Match : GP46 (HMM E-Value=5) 27 8.8 SB_28194| Best HMM Match : ResIII (HMM E-Value=0.72) 27 8.8 SB_23107| Best HMM Match : ResIII (HMM E-Value=0.045) 27 8.8 SB_15828| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_3900| Best HMM Match : DUF1070 (HMM E-Value=1) 27 8.8 SB_35990| Best HMM Match : ResIII (HMM E-Value=2) 27 8.8 SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) 27 8.8 SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_19979| Best HMM Match : Mo-co_dimer (HMM E-Value=6) 27 8.8 SB_14622| Best HMM Match : DUF1441 (HMM E-Value=1.6) 27 8.8 SB_11642| Best HMM Match : LIM (HMM E-Value=1.4) 27 8.8 SB_3287| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 >SB_33983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 34.7 bits (76), Expect = 0.033 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 384 DWLRVVASAHDSYELRY 434 DWLRVVA+ H SYELRY Sbjct: 18 DWLRVVAADHTSYELRY 34 >SB_2161| Best HMM Match : Ribosomal_L22e (HMM E-Value=1.1e-05) Length = 50 Score = 34.7 bits (76), Expect = 0.033 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 384 DWLRVVASAHDSYELRY 434 DWLRVVA+ H SYELRY Sbjct: 18 DWLRVVAADHTSYELRY 34 >SB_2130| Best HMM Match : fn2 (HMM E-Value=2.7e-15) Length = 430 Score = 31.1 bits (67), Expect = 0.41 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 226 KNVLKLKAKQITWAITLSSPGTRQKSLSTQTFPSQRG-ISNT*PSVT 363 K V K +Q+ AI + T+QK++ T+TFP R I NT +T Sbjct: 146 KPVKKTNVEQVLRAIAKPASNTQQKNVVTETFPQLRDIIGNTMIKIT 192 >SB_44986| Best HMM Match : Ion_trans_2 (HMM E-Value=6.9e-15) Length = 711 Score = 30.3 bits (65), Expect = 0.72 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +3 Query: 162 IDCTHPAEDSILDVGNFEKYLKERV--KVEGKTNNLGNHVV 278 + C H +E S L + + Y ++ KVE NNL NHV+ Sbjct: 376 LPCVHSSETSELFAQDLKMYYVQKAFSKVEPMLNNLSNHVI 416 >SB_43215| Best HMM Match : ResIII (HMM E-Value=7.9) Length = 235 Score = 29.9 bits (64), Expect = 0.95 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +2 Query: 17 HVFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 HV CC D G KE P ++W + + RW S RCQ ED Sbjct: 107 HVVCCGDYGQVPPWGDKEGPHDMLKEWAQGNIRWFESDYRCQCED 151 >SB_20002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2484 Score = 28.7 bits (61), Expect = 2.2 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 188 ILSRVCAVNGKFKANLPLGTFAANFATFYSFLTSLL 81 ++ CA+ G LP+ A+NF+ FY++ + L Sbjct: 1999 VVGSACAICGVLVIALPVSVVASNFSIFYTYAKARL 2034 >SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3133 Score = 28.3 bits (60), Expect = 2.9 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +2 Query: 20 VFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 V CC D G KE P ++W +R+ RW S RC ED Sbjct: 2969 VVCCGDYGQVPPLGDKEEPHDMLKEWAQRNIRWFESDYRCLCED 3012 >SB_55881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 28.3 bits (60), Expect = 2.9 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +2 Query: 20 VFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 V CC D G KERP ++W + + RW S RC ED Sbjct: 550 VVCCGDYGQVPPWGDKERPHDMLKEWAQGNIRWFESDYRCLSED 593 >SB_44112| Best HMM Match : PA14 (HMM E-Value=5e-05) Length = 1433 Score = 27.9 bits (59), Expect = 3.8 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +2 Query: 20 VFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 V CC D G KE P + W +R+ RW S RCQ ED Sbjct: 1128 VVCCGDYGQVPPWGDKEGPHDMLKAWAQRNIRWFESDYRCQCED 1171 >SB_28078| Best HMM Match : SGS (HMM E-Value=1.5) Length = 934 Score = 27.9 bits (59), Expect = 3.8 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 197 QDAILSRVCAVNGKFKANLPLGTFAANFATFYS 99 Q I+ +CAV G LP+ +NF+ +YS Sbjct: 7 QGQIVGSLCAVCGVLMIALPVPVIVSNFSLYYS 39 >SB_9898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -1 Query: 188 ILSRVCAVNGKFKANLPLGTFAANFATFYSF 96 ++ VCA++G LP+ A+NF+ + S+ Sbjct: 386 LVGSVCAISGVLMIALPVSVVASNFSLYNSY 416 >SB_34697| Best HMM Match : Ion_trans (HMM E-Value=7.9e-38) Length = 1851 Score = 27.9 bits (59), Expect = 3.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 188 ILSRVCAVNGKFKANLPLGTFAANFATFY 102 +LS CA+ G LP+ TF +NF Y Sbjct: 1790 LLSAACAIFGAITLALPVLTFVSNFNKLY 1818 >SB_33294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 983 Score = 27.9 bits (59), Expect = 3.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 290 QDKSRYQRRHSLLKEVSQIPDQALPQEKQSSGLAP 394 Q++ + QRR L ++ Q P Q LPQ Q P Sbjct: 802 QERQQLQRRQLLQQQQQQKPKQLLPQRVQQQQYLP 836 >SB_3220| Best HMM Match : Ion_trans (HMM E-Value=5.6e-22) Length = 256 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 188 ILSRVCAVNGKFKANLPLGTFAANFATFYS 99 I+ +CA++G LP+ +NF FY+ Sbjct: 167 IVGALCAISGVLTIALPVPVIVSNFENFYN 196 >SB_43676| Best HMM Match : Ion_trans (HMM E-Value=1.2e-39) Length = 605 Score = 27.1 bits (57), Expect = 6.7 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -1 Query: 188 ILSRVCAVNGKFKANLPLGTFAANFATFY 102 I+ +CA+ G LP+ NF+T+Y Sbjct: 392 IIGSLCAICGVLIIGLPVSVIGNNFSTYY 420 >SB_8959| Best HMM Match : PAN (HMM E-Value=0.013) Length = 450 Score = 27.1 bits (57), Expect = 6.7 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -1 Query: 161 GKFKANLPLGTFAANFATFYSFLTSLLV*LAFLCDGLLCNCHLGN 27 G F+ ++ G NF+ FY FL + L G+L N H+ N Sbjct: 294 GTFRVDVVDGPATNNFSVFYQFLMVATM-LNVALPGILLNIHILN 337 >SB_38850| Best HMM Match : ResIII (HMM E-Value=0.045) Length = 382 Score = 26.6 bits (56), Expect = 8.8 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +2 Query: 20 VFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 V CC D G KE P E+W + + RW S RC ED Sbjct: 311 VVCCGDYGQVSPWGNKEGPHDMLEEWAQGNIRWFESDYRCLCED 354 >SB_37320| Best HMM Match : GP46 (HMM E-Value=5) Length = 555 Score = 26.6 bits (56), Expect = 8.8 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +2 Query: 20 VFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 V CC D G KE P E+W + + RW S RC ED Sbjct: 508 VVCCGDYGQVPPWEDKEGPHDMLEEWAQGNIRWFESDYRCPCED 551 >SB_28194| Best HMM Match : ResIII (HMM E-Value=0.72) Length = 309 Score = 26.6 bits (56), Expect = 8.8 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +2 Query: 20 VFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 V CC D G KE P E+W + + RW S RC ED Sbjct: 255 VVCCGDYGQVPPWEDKEGPHDMLEEWAQGNIRWFESDYRCPCED 298 >SB_23107| Best HMM Match : ResIII (HMM E-Value=0.045) Length = 418 Score = 26.6 bits (56), Expect = 8.8 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +2 Query: 20 VFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 V CC D G KE P E+W + + RW S RC ED Sbjct: 347 VVCCGDYGQVSPWGNKEGPHDMLEEWAQGNIRWFESDYRCLCED 390 >SB_15828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 578 Score = 26.6 bits (56), Expect = 8.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 173 CAVNGKFKANLPLGTFAANFATFYS 99 CA++G LP+ +NFA +YS Sbjct: 369 CAISGVLAIALPVPVIVSNFAYYYS 393 >SB_3900| Best HMM Match : DUF1070 (HMM E-Value=1) Length = 500 Score = 26.6 bits (56), Expect = 8.8 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +2 Query: 20 VFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 V CC D G KE P E+W + + RW S RC ED Sbjct: 316 VVCCGDYGQVSPWGNKEGPHDMLEEWAQGNIRWFESDYRCLCED 359 >SB_35990| Best HMM Match : ResIII (HMM E-Value=2) Length = 798 Score = 26.6 bits (56), Expect = 8.8 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +2 Query: 20 VFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 V CC D G KERP ++W + + RW S RC ED Sbjct: 734 VVCCGDYGQVPPWGDKERPHDMLKEWAQGNIRWFESDYRCLCED 777 >SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 1053 Score = 26.6 bits (56), Expect = 8.8 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +2 Query: 20 VFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 V CC D G R KE P ++W + + RW S RC ED Sbjct: 562 VVCCGDYGQVPPWRDKEGPHDMLKEWAQGNIRWFESDYRCLCED 605 >SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 26.6 bits (56), Expect = 8.8 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +2 Query: 20 VFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 V CC D G R KE P ++W + + RW S RC ED Sbjct: 500 VVCCGDYGQVPPWRDKEGPHDMLKEWAQGNIRWFESDYRCLCED 543 >SB_19979| Best HMM Match : Mo-co_dimer (HMM E-Value=6) Length = 551 Score = 26.6 bits (56), Expect = 8.8 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +2 Query: 20 VFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 V CC D G KE P EDW + + RW S RC ED Sbjct: 476 VVCCGDYGQVLPWGDKEGPHDMLEDWIQGNIRWFESDYRCLCED 519 >SB_14622| Best HMM Match : DUF1441 (HMM E-Value=1.6) Length = 426 Score = 26.6 bits (56), Expect = 8.8 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = -2 Query: 274 T*LPRLFVLPSTLTRSFKYFSKLPTSRMLSSAGCVQSMVNLRLIF-LLAPLPRILPPFTP 98 T +PRL LT + F++ R+ G +M ++ +F ++ + +++ PFTP Sbjct: 95 TVVPRLVKFIEYLTNWYVRFNR---KRLKGDQGQEDAMQAIQTLFGVVLTITKLMAPFTP 151 Query: 97 FL 92 FL Sbjct: 152 FL 153 >SB_11642| Best HMM Match : LIM (HMM E-Value=1.4) Length = 906 Score = 26.6 bits (56), Expect = 8.8 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +2 Query: 20 VFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 V CC D G KE P ++W +R+ RW S RC ED Sbjct: 679 VVCCGDYGQVPPWGDKEGPHDMLKEWAQRNIRWFESDYRCLCED 722 >SB_3287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1030 Score = 26.6 bits (56), Expect = 8.8 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +2 Query: 20 VFCCQD-GSYKEARRKERPVTP-EDW*ERSKRWQNSRQRCQEED 145 V CC D G R KE P ++W + + RW S RC ED Sbjct: 780 VVCCGDYGQVPPWRDKEGPHDMLKEWAQGNIRWFESDYRCLCED 823 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,504,783 Number of Sequences: 59808 Number of extensions: 263252 Number of successful extensions: 932 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 893 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 932 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 834771332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -