BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_J06 (450 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 4.0 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 4.0 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 4.0 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 4.0 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 4.0 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 4.0 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 4.0 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 4.0 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 7.1 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 7.1 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 7.1 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 20 9.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 20 9.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 20 9.4 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 4.0 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +1 Query: 322 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPD 441 H + P Y + +R+A+ P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 4.0 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +1 Query: 322 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPD 441 H + P Y + +R+A+ P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.4 bits (43), Expect = 4.0 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +1 Query: 322 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPD 441 H + P Y + +R+A+ P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 4.0 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +1 Query: 322 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPD 441 H + P Y + +R+A+ P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.4 bits (43), Expect = 4.0 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +1 Query: 322 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPD 441 H + P Y + +R+A+ P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.4 bits (43), Expect = 4.0 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +1 Query: 322 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPD 441 H + P Y + +R+A+ P TH + +Y D Sbjct: 20 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 59 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.4 bits (43), Expect = 4.0 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +1 Query: 322 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPD 441 H + P Y + +R+A+ P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 4.0 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +1 Query: 322 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPD 441 H + P Y + +R+A+ P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYAD 103 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 20.6 bits (41), Expect = 7.1 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = +2 Query: 47 WTSWAACTRRGPR 85 W +W CTR R Sbjct: 190 WPAWVYCTRYSDR 202 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 20.6 bits (41), Expect = 7.1 Identities = 6/16 (37%), Positives = 13/16 (81%) Frame = +1 Query: 154 LTGNEVLKIVKQRLIK 201 L N++LK++++ L+K Sbjct: 392 LQQNKILKVIRKNLVK 407 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 20.6 bits (41), Expect = 7.1 Identities = 10/40 (25%), Positives = 16/40 (40%) Frame = +1 Query: 322 HRITPEEAKYKLCKVRRVATGPKSVPYLVTHDGRTLRYPD 441 H + P Y + +R+A P TH + +Y D Sbjct: 64 HGLQPTMGDYTQLQPQRLAPTHLQSPNTQTHPSASCKYAD 103 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 20.2 bits (40), Expect = 9.4 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -2 Query: 119 SGKHSRSLWGPVEGRGAY 66 +GKH R + P + +G Y Sbjct: 347 AGKHLRKVGDPSKRKGTY 364 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.2 bits (40), Expect = 9.4 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -2 Query: 398 GTLLGPVATRRTLHSLYLASSGVIRW 321 GT++GP L ++A+ G+ +W Sbjct: 892 GTVIGPGTIFLMLVGAFVAAFGLDQW 917 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.2 bits (40), Expect = 9.4 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -2 Query: 398 GTLLGPVATRRTLHSLYLASSGVIRW 321 GT++GP L ++A+ G+ +W Sbjct: 892 GTVIGPGTIFLMLVGAFVAAFGLDQW 917 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,356 Number of Sequences: 336 Number of extensions: 2274 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -