BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_J04 (457 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0401 - 8146758-8146912,8147151-8147235,8147502-8147567,814... 28 3.1 12_01_1112 - 11866376-11866447,11866528-11866662,11866772-118669... 27 5.4 11_06_0143 + 20589574-20589684,20590256-20590873,20590943-205910... 27 7.2 10_08_0297 + 16602176-16602553 27 7.2 06_02_0182 - 12702890-12703387 27 7.2 02_04_0264 - 21393029-21393046,21394249-21394814,21395005-21395623 27 7.2 >03_02_0401 - 8146758-8146912,8147151-8147235,8147502-8147567, 8147744-8147802,8147911-8148013,8148227-8148358, 8148447-8148527,8148729-8148821,8148978-8149061, 8149242-8149300,8149405-8149481,8149639-8149789, 8150302-8150437 Length = 426 Score = 28.3 bits (60), Expect = 3.1 Identities = 21/61 (34%), Positives = 33/61 (54%) Frame = +1 Query: 49 PASADNSQNLQVKYVQLPSEGGGRTSAGASVGRGRRATGTPVKIILNRANFTKLLSPLSN 228 P+ AD + + KY +GGGR+SA ++ GR A G K IL + ++L+ +S Sbjct: 152 PSHADATYDF--KYGVRAVQGGGRSSARETI--GRVAAGALAKKILKLKSGVEILAFVSK 207 Query: 229 V 231 V Sbjct: 208 V 208 >12_01_1112 - 11866376-11866447,11866528-11866662,11866772-11866921, 11867263-11867338,11867426-11867559,11867655-11867747, 11868456-11868589,11868696-11868744,11869271-11869441, 11870291-11870452 Length = 391 Score = 27.5 bits (58), Expect = 5.4 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +1 Query: 106 EGGGRTSAGASVGRGRRATG--TPVKIILNRANF 201 EGGG+ +AGA+ + R A G T V N A F Sbjct: 23 EGGGKAAAGAAAAKKRVALGNITNVAAAANNAKF 56 >11_06_0143 + 20589574-20589684,20590256-20590873,20590943-20591010, 20591159-20591234,20591311-20591372,20591452-20591603, 20591889-20592052,20592129-20592317,20592417-20592538, 20592620-20592827,20593238-20593291,20593457-20593626, 20594265-20594355,20595405-20595529,20596372-20596444, 20596822-20596914,20597482-20597728,20598305-20598364, 20598461-20598590,20599008-20599014 Length = 939 Score = 27.1 bits (57), Expect = 7.2 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 61 DNSQNLQVKYVQLPSEGGGRTSAGASVGRGRRATG 165 D ++ + + PS+ GR GAS GRGR G Sbjct: 191 DGEEDKMDEDAKTPSKAAGRGRGGASGGRGRGGGG 225 >10_08_0297 + 16602176-16602553 Length = 125 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 97 LPSEGGGRTSAGASVGRGRRATGTPV 174 L S R +AG GRGRR G P+ Sbjct: 34 LSSRRASRAAAGGRGGRGRRKGGAPI 59 >06_02_0182 - 12702890-12703387 Length = 165 Score = 27.1 bits (57), Expect = 7.2 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +1 Query: 67 SQNLQVKYVQLPSEGGGRTSAGASVGRGRRA 159 S L + + +PS GGG TS A G+GRRA Sbjct: 56 SVRLLTRGLVVPSGGGGSTSPSAR-GKGRRA 85 >02_04_0264 - 21393029-21393046,21394249-21394814,21395005-21395623 Length = 400 Score = 27.1 bits (57), Expect = 7.2 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +1 Query: 40 QLVPASADNSQNLQVKYVQLPSEGGGRTSAGASVGRGRRATG 165 Q P +A + Q + GGGR AGA G G G Sbjct: 239 QAAPVAAQAQAAAMAEQAQGQAAGGGRGGAGAGGGHGGAGAG 280 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.313 0.130 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,473,027 Number of Sequences: 37544 Number of extensions: 72497 Number of successful extensions: 298 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 298 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 895500300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -