BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_J03 (575 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC342.01c |alg6|SPBC3F6.06c|glucosyltransferase Alg6|Schizosac... 27 2.6 SPAC12G12.12 |||NST UDP-galactose transporter|Schizosaccharomyce... 26 3.4 >SPBC342.01c |alg6|SPBC3F6.06c|glucosyltransferase Alg6|Schizosaccharomyces pombe|chr 2|||Manual Length = 506 Score = 26.6 bits (56), Expect = 2.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 470 LYDWQYLGFMVLLPMVLHWFF 532 L+ W Y+ + LLP +LH F Sbjct: 263 LFPWIYMDYKTLLPQILHRVF 283 >SPAC12G12.12 |||NST UDP-galactose transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 324 Score = 26.2 bits (55), Expect = 3.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 461 EPTLYDWQYLGFMVLLPMVLHWFFIDMVTIG 553 E Y+ Y F VLL M++ ++FI T G Sbjct: 192 ELVAYEGTYGVFFVLLGMIISYYFIGSTTAG 222 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,215,665 Number of Sequences: 5004 Number of extensions: 41572 Number of successful extensions: 70 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -