BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_J03 (575 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY089582-1|AAL90320.1| 304|Drosophila melanogaster RE11615p pro... 101 5e-22 AE014297-4808|AAF57197.2| 304|Drosophila melanogaster CG2126-PA... 101 5e-22 >AY089582-1|AAL90320.1| 304|Drosophila melanogaster RE11615p protein. Length = 304 Score = 101 bits (243), Expect = 5e-22 Identities = 40/70 (57%), Positives = 48/70 (68%) Frame = +2 Query: 332 AVRTCPGLYCGRTQLEDGLWSDCGACPRGFRTNVSSYCVPCEDEPTLYDWQYLGFMVLLP 511 A+ CPG YCGR+ L + WS CG CPRG R N S C PC DE + Y W YLGFM +LP Sbjct: 6 ALERCPGAYCGRSPLGNNSWSSCGVCPRGSRVNQSYACSPCRDELSTYSWLYLGFMTMLP 65 Query: 512 MVLHWFFIDM 541 +++H FFIDM Sbjct: 66 LMMHCFFIDM 75 >AE014297-4808|AAF57197.2| 304|Drosophila melanogaster CG2126-PA protein. Length = 304 Score = 101 bits (243), Expect = 5e-22 Identities = 40/70 (57%), Positives = 48/70 (68%) Frame = +2 Query: 332 AVRTCPGLYCGRTQLEDGLWSDCGACPRGFRTNVSSYCVPCEDEPTLYDWQYLGFMVLLP 511 A+ CPG YCGR+ L + WS CG CPRG R N S C PC DE + Y W YLGFM +LP Sbjct: 6 ALERCPGAYCGRSPLGNNSWSSCGVCPRGSRVNQSYACSPCRDELSTYSWLYLGFMTMLP 65 Query: 512 MVLHWFFIDM 541 +++H FFIDM Sbjct: 66 LMMHCFFIDM 75 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,460,257 Number of Sequences: 53049 Number of extensions: 454451 Number of successful extensions: 950 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 915 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 950 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2276053890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -