BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_J03 (575 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 1.6 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 1.6 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 1.6 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.7 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 8.7 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.4 bits (48), Expect = 1.6 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +2 Query: 383 GLWSDCGACPRGFRTNVSSYCVPCEDEPTLYDWQ--YLGFMVLLPMVLH 523 G WS A R + S+ C CE +P + D+ Y G+ L + H Sbjct: 199 GTWSPDPAINRRLKETYSNMCALCE-KPEVCDYPDIYSGYEGALRCLAH 246 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.4 bits (48), Expect = 1.6 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +2 Query: 383 GLWSDCGACPRGFRTNVSSYCVPCEDEPTLYDWQ--YLGFMVLLPMVLH 523 G WS A R + S+ C CE +P + D+ Y G+ L + H Sbjct: 199 GTWSPDPAINRRLKETYSNMCALCE-KPEVCDYPDIYSGYEGALRCLAH 246 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.4 bits (48), Expect = 1.6 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +2 Query: 383 GLWSDCGACPRGFRTNVSSYCVPCEDEPTLYDWQ--YLGFMVLLPMVLH 523 G WS A R + S+ C CE +P + D+ Y G+ L + H Sbjct: 199 GTWSPDPAINRRLKETYSNMCALCE-KPEVCDYPDIYSGYEGALRCLAH 246 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 8.7 Identities = 12/52 (23%), Positives = 22/52 (42%) Frame = -1 Query: 521 VTPWATEP*NLSTASHTMLVHLHKAHNNLRHLS*NREDKPRNHSTAHLLIVF 366 V+P P ++ ++ L K + H S N+E + + HL + F Sbjct: 219 VSPQEERPKGINGRRASLFCGLQKYTRSFAHQSINKEARSNLYLPFHLTLSF 270 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 8.7 Identities = 12/52 (23%), Positives = 22/52 (42%) Frame = -1 Query: 521 VTPWATEP*NLSTASHTMLVHLHKAHNNLRHLS*NREDKPRNHSTAHLLIVF 366 V+P P ++ ++ L K + H S N+E + + HL + F Sbjct: 214 VSPQEERPKGINGRRASLFCGLQKYTRSFAHQSINKEARSNLYLPFHLTLSF 265 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,217 Number of Sequences: 438 Number of extensions: 2897 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16626408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -