BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_I21 (448 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 21 4.6 DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 21 8.1 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.4 bits (43), Expect = 4.6 Identities = 11/49 (22%), Positives = 17/49 (34%) Frame = -2 Query: 147 DVLSGISISDFIDLVGIKPHPLFTASYIRECKPSSVTLGNSSWHGETSC 1 D + F+ G P P+ + + C G+ W E SC Sbjct: 27 DECQATPVIHFLQYPGCVPKPIPSYACRGRCSSYLQVSGSKIWQMERSC 75 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 20.6 bits (41), Expect = 8.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 272 VQLMLECHKKNYGFKGK 322 VQL +EC K + F K Sbjct: 59 VQLYIECAMKKFSFVDK 75 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,045 Number of Sequences: 438 Number of extensions: 2416 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11697255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -