BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_I19 (392 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0683 - 26703486-26703539,26703639-26703797 28 2.3 02_05_0567 + 30029862-30030136,30030299-30030384,30031663-300318... 27 7.1 >03_05_0683 - 26703486-26703539,26703639-26703797 Length = 70 Score = 28.3 bits (60), Expect = 2.3 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 272 KLK*TDQKHELSQQKKLRSSWSLW 343 +L T QK E +Q+KK +S W++W Sbjct: 10 RLHITKQKREDNQRKKNQSKWNIW 33 >02_05_0567 + 30029862-30030136,30030299-30030384,30031663-30031811, 30032581-30032685,30032779-30032895,30033251-30033394, 30033519-30033668 Length = 341 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +2 Query: 65 IHPLGCTILKNSYIRVHLFLTRSKYSPFTVILPLAIEL 178 + +GC+I + L R K SPF +LP ++ L Sbjct: 80 VEQVGCSIQRLLRYLAELLAERHKLSPFIPVLPNSVRL 117 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,616,946 Number of Sequences: 37544 Number of extensions: 134496 Number of successful extensions: 236 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 236 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 672845152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -