BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_I18 (405 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p... 34 0.041 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 34 0.041 At4g29830.1 68417.m04246 transducin family protein / WD-40 repea... 27 0.066 At5g08390.1 68418.m00988 transducin family protein / WD-40 repea... 31 0.22 At2g46280.3 68415.m05757 eukaryotic translation initiation facto... 31 0.22 At2g46280.2 68415.m05756 eukaryotic translation initiation facto... 31 0.22 At2g46280.1 68415.m05755 eukaryotic translation initiation facto... 31 0.22 At5g23430.2 68418.m02749 transducin family protein / WD-40 repea... 31 0.39 At5g23430.1 68418.m02748 transducin family protein / WD-40 repea... 31 0.39 At3g53390.1 68416.m05892 transducin family protein / WD-40 repea... 30 0.68 At2g46290.1 68415.m05758 eukaryotic translation initiation facto... 29 0.89 At2g18900.1 68415.m02205 transducin family protein / WD-40 repea... 29 0.89 At2g37160.1 68415.m04559 transducin family protein / WD-40 repea... 29 1.2 At3g06880.1 68416.m00817 transducin family protein / WD-40 repea... 29 1.6 At5g52250.1 68418.m06485 transducin family protein / WD-40 repea... 28 2.1 At1g49450.1 68414.m05543 transducin family protein / WD-40 repea... 28 2.1 At2g30050.1 68415.m03654 transducin family protein / WD-40 repea... 28 2.7 At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 pro... 27 3.6 At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 pro... 27 3.6 At2g43770.1 68415.m05441 transducin family protein / WD-40 repea... 27 3.6 At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless... 27 4.8 At3g01340.1 68416.m00051 protein transport protein SEC13 family ... 27 6.3 At2g31300.1 68415.m03821 transducin family protein / WD-40 repea... 27 6.3 At2g22040.1 68415.m02617 transducin family protein / WD-40 repea... 27 6.3 At5g49070.1 68418.m06072 beta-ketoacyl-CoA synthase family prote... 26 8.3 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 26 8.3 At4g01860.2 68417.m00244 transducin family protein / WD-40 repea... 26 8.3 At4g01860.1 68417.m00243 transducin family protein / WD-40 repea... 26 8.3 At2g30910.2 68415.m03768 transducin family protein / WD-40 repea... 26 8.3 At2g30910.1 68415.m03767 transducin family protein / WD-40 repea... 26 8.3 >At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p80 subunit, putative contains 5 WD-40 repeats (PF00400); similar to katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 1180 Score = 33.9 bits (74), Expect = 0.041 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = +3 Query: 321 FIITGGLDDVIKVWQLDNGKL 383 ++++GGLD+V+KVW L GKL Sbjct: 156 WVVSGGLDNVVKVWDLTAGKL 176 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 33.9 bits (74), Expect = 0.041 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = +3 Query: 321 FIITGGLDDVIKVWQLDNGKL 383 ++++GGLD+V+KVW L GKL Sbjct: 105 WVVSGGLDNVVKVWDLTAGKL 125 >At4g29830.1 68417.m04246 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); G protein beta subunit-like protein, Schistosoma mansoni, gb:U30261 Length = 321 Score = 27.5 bits (58), Expect(2) = 0.066 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 186 ENAHDDSIWCCGW 224 ENAH+DS+W W Sbjct: 10 ENAHEDSVWAATW 22 Score = 24.6 bits (51), Expect(2) = 0.066 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +3 Query: 324 IITGGLDDVIKVWQLD 371 ++TG LD+ +K+W+ D Sbjct: 33 LLTGSLDETVKLWRPD 48 >At5g08390.1 68418.m00988 transducin family protein / WD-40 repeat family protein similar to katanin p80 subunit [Strongylocentrotus purpuratus] GI:3005601; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 871 Score = 31.5 bits (68), Expect = 0.22 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +3 Query: 321 FIITGGLDDVIKVWQLDNGKL 383 +I++GG D+V+KVW L GKL Sbjct: 250 WIVSGGEDNVVKVWDLTAGKL 270 >At2g46280.3 68415.m05757 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 254 Score = 31.5 bits (68), Expect = 0.22 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 291 NHSGTGNVDNFIITGGLDDVIKVWQLDNGKL 383 N + G ++ I++GG D VI++W + GKL Sbjct: 152 NRAVWGPLNQTIVSGGEDKVIRIWDAETGKL 182 Score = 24.2 bits (50), Expect(2) = 2.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 324 IITGGLDDVIKVWQLDNGK 380 +ITG D K+W + +GK Sbjct: 67 LITGSADQTAKLWDVKSGK 85 Score = 22.6 bits (46), Expect(2) = 2.0 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +3 Query: 195 HDDSIWCCGWSR 230 H+ ++WCC SR Sbjct: 51 HNGAVWCCDVSR 62 >At2g46280.2 68415.m05756 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 328 Score = 31.5 bits (68), Expect = 0.22 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 291 NHSGTGNVDNFIITGGLDDVIKVWQLDNGKL 383 N + G ++ I++GG D VI++W + GKL Sbjct: 152 NRAVWGPLNQTIVSGGEDKVIRIWDAETGKL 182 Score = 24.2 bits (50), Expect(2) = 2.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 324 IITGGLDDVIKVWQLDNGK 380 +ITG D K+W + +GK Sbjct: 67 LITGSADQTAKLWDVKSGK 85 Score = 22.6 bits (46), Expect(2) = 2.0 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +3 Query: 195 HDDSIWCCGWSR 230 H+ ++WCC SR Sbjct: 51 HNGAVWCCDVSR 62 >At2g46280.1 68415.m05755 eukaryotic translation initiation factor 3 subunit 2 / TGF-beta receptor interacting protein 1 / eIF-3 beta / eIF3i / TRIP-1 (TIF3I1) identical to eukaryotic translation initiation factor 3 subunit 2 (SP:Q38884) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies) Length = 328 Score = 31.5 bits (68), Expect = 0.22 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 291 NHSGTGNVDNFIITGGLDDVIKVWQLDNGKL 383 N + G ++ I++GG D VI++W + GKL Sbjct: 152 NRAVWGPLNQTIVSGGEDKVIRIWDAETGKL 182 Score = 24.2 bits (50), Expect(2) = 2.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 324 IITGGLDDVIKVWQLDNGK 380 +ITG D K+W + +GK Sbjct: 67 LITGSADQTAKLWDVKSGK 85 Score = 22.6 bits (46), Expect(2) = 2.0 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +3 Query: 195 HDDSIWCCGWSR 230 H+ ++WCC SR Sbjct: 51 HNGAVWCCDVSR 62 >At5g23430.2 68418.m02749 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 836 Score = 30.7 bits (66), Expect = 0.39 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +3 Query: 321 FIITGGLDDVIKVWQLDNGKL 383 ++++GG D+++KVW L GKL Sbjct: 157 WVVSGGEDNIVKVWDLTAGKL 177 >At5g23430.1 68418.m02748 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 837 Score = 30.7 bits (66), Expect = 0.39 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +3 Query: 321 FIITGGLDDVIKVWQLDNGKL 383 ++++GG D+++KVW L GKL Sbjct: 157 WVVSGGEDNIVKVWDLTAGKL 177 >At3g53390.1 68416.m05892 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to Dystrophia myotonica-containing WD repeat motif protein DMR-N9 protein (DMWD) (DM9) (SP:Q08274) [Mus musculus]; simlar to DMR protein GI:18028289 [Homo sapiens]; Length = 558 Score = 29.9 bits (64), Expect = 0.68 Identities = 9/21 (42%), Positives = 18/21 (85%) Frame = +3 Query: 321 FIITGGLDDVIKVWQLDNGKL 383 +I+TGG DD+++VW +++ K+ Sbjct: 359 YILTGGEDDLVQVWSMEDRKV 379 >At2g46290.1 68415.m05758 eukaryotic translation initiation factor 3 subunit 2, putative / eIF-3 beta, putative / eIF3i, putative strong similarity to SP|Q38884 Eukaryotic translation initiation factor 3 subunit 2 (eIF-3 beta) (eIF3 p36) (eIF3i) (TGF-beta receptor interacting protein 1) (TRIP-1) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (5 copies)|19799885|gb|AU231175.1|AU231175 Length = 355 Score = 29.5 bits (63), Expect = 0.89 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +3 Query: 291 NHSGTGNVDNFIITGGLDDVIKVWQLDNGKL 383 N + G ++ I++GG D I++W + GKL Sbjct: 179 NRAVWGPLNQTIVSGGEDAAIRIWDAETGKL 209 Score = 24.2 bits (50), Expect(2) = 2.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 324 IITGGLDDVIKVWQLDNGK 380 +ITG D K+W + +GK Sbjct: 94 LITGSADQTAKLWDVKSGK 112 Score = 22.2 bits (45), Expect(2) = 2.6 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = +3 Query: 195 HDDSIWCCGWSR 230 H ++WCC SR Sbjct: 78 HSGAVWCCDISR 89 >At2g18900.1 68415.m02205 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); related to LACK protective antigen (GI:13625467) [Leishmania donovani] Length = 804 Score = 29.5 bits (63), Expect = 0.89 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 6/35 (17%) Frame = +3 Query: 294 HSGTGNVDNF------IITGGLDDVIKVWQLDNGK 380 HS NV NF + +GG + V+ VWQLD GK Sbjct: 282 HSAEVNVLNFSSDGAYLYSGGREGVLVVWQLDTGK 316 >At2g37160.1 68415.m04559 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to Dystrophia myotonica-containing WD repeat motif protein DMR-N9 protein (DMWD) (DM9) (SP:Q08274) [Mus musculus]; simlar to DMR protein GI:18028289 [Homo sapiens]; Length = 544 Score = 29.1 bits (62), Expect = 1.2 Identities = 8/21 (38%), Positives = 18/21 (85%) Frame = +3 Query: 321 FIITGGLDDVIKVWQLDNGKL 383 +++TGG DD+++VW +++ K+ Sbjct: 359 YLLTGGEDDLVQVWSMEDRKV 379 >At3g06880.1 68416.m00817 transducin family protein / WD-40 repeat family protein similar to PAK/PLC-interacting protein 1 (GI:4211689) {Homo sapiens} Length = 1115 Score = 28.7 bits (61), Expect = 1.6 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 324 IITGGLDDVIKVWQLDNGKLE 386 +++G D I+VWQ+ GKLE Sbjct: 910 VLSGSADKTIRVWQIVKGKLE 930 >At5g52250.1 68418.m06485 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to photomorphogenesis repressor PnCOP1 (GI:11127996) [Ipomoea nil] Length = 385 Score = 28.3 bits (60), Expect = 2.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 324 IITGGLDDVIKVWQLDNGKLELR 392 I+TG D +K W +DNG+ +R Sbjct: 270 IVTGSTDGSLKQWDIDNGRRVVR 292 >At1g49450.1 68414.m05543 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein GI:2739374 from [Arabidopsis thaliana]; no characterized homologs Length = 471 Score = 28.3 bits (60), Expect = 2.1 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +3 Query: 285 DSNHSGTGNVDNFIITGGLDDVIKVWQLDNGKLELRHQL 401 D+ ++ D+ + TG D +KVW+ + E++H L Sbjct: 288 DAVNTVVSGFDDLVFTGSADGTLKVWKREVQGKEMKHVL 326 >At2g30050.1 68415.m03654 transducin family protein / WD-40 repeat family protein similar to SEC13-related protein (SP:P55735) [Homo sapiens] Length = 302 Score = 27.9 bits (59), Expect = 2.7 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 324 IITGGLDDVIKVWQLDNGKLEL 389 + +GG D+ +KVW+L NG ++ Sbjct: 179 LASGGCDNTVKVWKLANGSWKM 200 >At5g51980.1 68418.m06451 WD-40 repeat family protein / zfwd2 protein (ZFWD2), putative 99.8% identical to zfwd2 protein (GI:12057166) [Arabidopsis thaliana]; contains 6 copies (2 weak) Pfam PF00400: WD domain, G-beta repeat; contains Pfam PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) domain Length = 437 Score = 27.5 bits (58), Expect = 3.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 318 NFIITGGLDDVIKVWQLDN 374 N + +G +D IKVW LDN Sbjct: 285 NRLYSGSMDKTIKVWSLDN 303 Score = 26.6 bits (56), Expect = 6.3 Identities = 9/28 (32%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +3 Query: 315 DNFIITGGLDDVIKVW-QLDNGKLELRH 395 D F+++ LD+ +K+W ++ G LE+ + Sbjct: 324 DQFLLSCSLDNTVKIWAAIEGGNLEVTY 351 >At4g25440.1 68417.m03663 WD-40 repeat family protein / zfwd1 protein (ZFWD1) identical to zfwd1 protein (GI:12057164) [Arabidopsis thaliana] Length = 430 Score = 27.5 bits (58), Expect = 3.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 318 NFIITGGLDDVIKVWQLDN 374 N + +G +D+ IKVW LDN Sbjct: 278 NRLYSGAMDNSIKVWSLDN 296 >At2g43770.1 68415.m05441 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to U5 snRNP-specific 40 kDa protein (GI:3820594) [Homo sapiens] Length = 343 Score = 27.5 bits (58), Expect = 3.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 324 IITGGLDDVIKVWQLDNGK 380 I TGG+D+ +KVW L G+ Sbjct: 195 IFTGGVDNDVKVWDLRKGE 213 >At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless protein, putative similar to notchless [Xenopus laevis] GI:3687833; contains Pfam PF00400: WD domain, G-beta repeat (8 copies) Length = 473 Score = 27.1 bits (57), Expect = 4.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 315 DNFIITGGLDDVIKVWQLDNGKL 383 D I TG D IK+W+ GKL Sbjct: 252 DGIIYTGSQDCTIKMWETTQGKL 274 >At3g01340.1 68416.m00051 protein transport protein SEC13 family protein / WD-40 repeat family protein similar to Protein transport protein SEC13 SP|Q04491 {Saccharomyces cerevisiae} and SEC13 (SP:P53024) [Pichia pastoris] Length = 302 Score = 26.6 bits (56), Expect = 6.3 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 324 IITGGLDDVIKVWQLDNGKLEL 389 + +GG D +KVW+ NG ++ Sbjct: 179 LASGGCDSTVKVWKFSNGSWKM 200 >At2g31300.1 68415.m03821 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); identical to putative ARP2/3 protein complex subunit p41 (GI:4432825)[Arabidopsis thaliana]; similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:Q9WV32) [Mus musculus] Length = 378 Score = 26.6 bits (56), Expect = 6.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 330 TGGLDDVIKVWQLDNGKLELRHQ 398 T GLD I +W L+N + EL +Q Sbjct: 355 TSGLDGKIAIWDLENMQQELGNQ 377 >At2g22040.1 68415.m02617 transducin family protein / WD-40 repeat family protein similar to Pop3 (GI:3434986) [Schizosaccharomyces pombe]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak); Length = 312 Score = 26.6 bits (56), Expect = 6.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 315 DNFIITGGLDDVIKVWQLDNGKLE 386 + ++ T D +K+W LD KLE Sbjct: 229 NKYLATASSDKTVKIWNLDGFKLE 252 >At5g49070.1 68418.m06072 beta-ketoacyl-CoA synthase family protein similar to very-long-chain fatty acid condensing enzyme CUT1 [GI:5001734], beta-ketoacyl-CoA synthase [Simmondsia chinensis][GI:1045614] Length = 464 Score = 26.2 bits (55), Expect = 8.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 285 LENFRYFHFHLLCYSLFLYGSN 220 LE F+Y H+LC L +Y SN Sbjct: 318 LEQFQYVIQHILCKKLKIYESN 339 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 26.2 bits (55), Expect = 8.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 174 QLKKENAHDDSIWCCGWSRI 233 Q++ NAHD+S+W W I Sbjct: 388 QIEIPNAHDNSVWDLAWHPI 407 >At4g01860.2 68417.m00244 transducin family protein / WD-40 repeat family protein contains ten G-protein beta-subunit (beta-transducin) WD-40 repeats Length = 1308 Score = 26.2 bits (55), Expect = 8.3 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 315 DNFIITGGLDDVIKVWQLDNGKLEL 389 D+ I+T G D +VW +D +LE+ Sbjct: 288 DSLIVTAGEDCTCRVWGVDGTQLEV 312 >At4g01860.1 68417.m00243 transducin family protein / WD-40 repeat family protein contains ten G-protein beta-subunit (beta-transducin) WD-40 repeats Length = 1308 Score = 26.2 bits (55), Expect = 8.3 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 315 DNFIITGGLDDVIKVWQLDNGKLEL 389 D+ I+T G D +VW +D +LE+ Sbjct: 288 DSLIVTAGEDCTCRVWGVDGTQLEV 312 >At2g30910.2 68415.m03768 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400) (1 weak); similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:O88656) [Rattus norvegicus] Length = 378 Score = 26.2 bits (55), Expect = 8.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 330 TGGLDDVIKVWQLDNGKLELRHQ 398 T GLD + +W L+N + EL +Q Sbjct: 355 TSGLDGKVAIWDLENMEQELGNQ 377 >At2g30910.1 68415.m03767 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400) (1 weak); similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:O88656) [Rattus norvegicus] Length = 378 Score = 26.2 bits (55), Expect = 8.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 330 TGGLDDVIKVWQLDNGKLELRHQ 398 T GLD + +W L+N + EL +Q Sbjct: 355 TSGLDGKVAIWDLENMEQELGNQ 377 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,159,935 Number of Sequences: 28952 Number of extensions: 108566 Number of successful extensions: 375 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 595686720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -