BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_I17 (477 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40799-9|AAA81488.2| 1292|Caenorhabditis elegans Hypothetical pr... 27 7.0 Z95559-16|CAB63365.3| 1440|Caenorhabditis elegans Hypothetical p... 27 9.2 >U40799-9|AAA81488.2| 1292|Caenorhabditis elegans Hypothetical protein F42C5.10 protein. Length = 1292 Score = 27.1 bits (57), Expect = 7.0 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 442 PGIEPETSERQSHRNTTAPPRHHL 371 P +P T+E+ +R + APP HHL Sbjct: 1149 PDEKPLTTEQVIYRVSAAPPGHHL 1172 >Z95559-16|CAB63365.3| 1440|Caenorhabditis elegans Hypothetical protein Y41E3.9 protein. Length = 1440 Score = 26.6 bits (56), Expect = 9.2 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 177 FQFWKLDYNHHLLQKLFPFFFIDSTKGTSTATRQKKEC 290 ++FW + + L+ L P F D + STA R KEC Sbjct: 228 WRFWSPNVRNDLIAAL-PEIFTDISLQQSTAVRLHKEC 264 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,543,331 Number of Sequences: 27780 Number of extensions: 201217 Number of successful extensions: 543 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 871571276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -