SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0002_I16
         (491 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    22   2.6  
AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine recombi...    21   6.1  
AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    21   6.1  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    21   6.1  
EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450 ...    21   8.0  

>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 22.2 bits (45), Expect = 2.6
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = +3

Query: 417 GSVDCIALCLDFHGN 461
           G++DC+ L  D+H N
Sbjct: 311 GTLDCVQLVNDYHCN 325


>AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine
           recombinase protein.
          Length = 340

 Score = 21.0 bits (42), Expect = 6.1
 Identities = 5/12 (41%), Positives = 9/12 (75%)
 Frame = +3

Query: 357 LPDIFRVPGPHR 392
           +PD+ +  GPH+
Sbjct: 199 IPDVIKTSGPHK 210


>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 21.0 bits (42), Expect = 6.1
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = +1

Query: 199 NGQPNYVDRADFP 237
           NG PNY+    FP
Sbjct: 444 NGDPNYISPEVFP 456


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 21.0 bits (42), Expect = 6.1
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = +1

Query: 199 NGQPNYVDRADFP 237
           NG PNY+    FP
Sbjct: 392 NGDPNYISPEVFP 404


>EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450
           protein.
          Length = 493

 Score = 20.6 bits (41), Expect = 8.0
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = -2

Query: 421 DPSPQLPSILRWGPGTRNMSGRMKLGRELSSL 326
           DP+ + P  LR+ PG+  +  R  L  ++S +
Sbjct: 461 DPTERTPVPLRFDPGSLFVQNRGGLYLKVSKI 492


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 127,489
Number of Sequences: 336
Number of extensions: 2672
Number of successful extensions: 8
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 11525470
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -