BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_I14 (263 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual 25 1.3 SPAC631.02 |||bromodomain protein|Schizosaccharomyces pombe|chr ... 25 1.3 SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyce... 24 4.0 SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|... 23 5.3 SPAC17H9.04c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 23 7.0 SPAC3G9.13c |msw1||mitochondrial tryptophan-tRNA ligase Msw1 |Sc... 23 7.0 SPAC57A7.06 |||U3 snoRNP protein Utp14 |Schizosaccharomyces pomb... 23 9.2 >SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual Length = 1496 Score = 25.4 bits (53), Expect = 1.3 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 158 RCIWRKQTQCEIRAWRTERSC*NFRRSS 241 RCIWRK +C A+ +ER+ FR S Sbjct: 163 RCIWRKGKKCH-SAYISERTKPIFRSES 189 >SPAC631.02 |||bromodomain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 727 Score = 25.4 bits (53), Expect = 1.3 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 105 ANEDEGKLELFSGVVIEKDASGENK 179 + D+G L+LF +EK+ G+N+ Sbjct: 55 SENDDGTLDLFGDSELEKEQKGDNQ 79 >SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2310 Score = 23.8 bits (49), Expect = 4.0 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 Query: 45 CVYCVWYYA 71 C +C WYYA Sbjct: 1166 CTFCCWYYA 1174 >SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1402 Score = 23.4 bits (48), Expect = 5.3 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +3 Query: 105 ANEDEGKL--ELFSGVVIEKDASGENKLNVKFEPGELREAARTFEEARGKI 251 A ++E K L V +E A E++ + E EA R+FE+++GK+ Sbjct: 207 AKQEEKKRAKRLNDAVPLEDMAGSESRPSYDSIFRESFEAKRSFEDSKGKV 257 >SPAC17H9.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 23.0 bits (47), Expect = 7.0 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 153 EKDASGENKLNVKFEPGELREAARTFEEARGKI 251 EKD+ G + +V +P + AR+F R KI Sbjct: 213 EKDSRGHSLPSVLTQPINCQADARSFYAERSKI 245 >SPAC3G9.13c |msw1||mitochondrial tryptophan-tRNA ligase Msw1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 361 Score = 23.0 bits (47), Expect = 7.0 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -3 Query: 120 LHLHSPPTGAALQATTMHNTKHNTRIFSKFTLKLSGFLV 4 LHLH + L A+ +T+ N +FS L+ + L+ Sbjct: 130 LHLHDHDDLSFLDASATSSTRFNLGLFSYPVLQAADILL 168 >SPAC57A7.06 |||U3 snoRNP protein Utp14 |Schizosaccharomyces pombe|chr 1|||Manual Length = 929 Score = 22.6 bits (46), Expect = 9.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 108 NEDEGKLELFSGVVIEKDASGENKLNVKFE 197 NE+E KL+ G+ +DAS K V+ E Sbjct: 574 NEEEPKLKGVLGMKFMRDASNRQKALVQDE 603 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,021,514 Number of Sequences: 5004 Number of extensions: 16858 Number of successful extensions: 35 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 2,362,478 effective HSP length: 61 effective length of database: 2,057,234 effective search space used: 53488084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -