BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_I12 (319 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC11C11.09c |rpl502|rpl5-2, rpl5b|60S ribosomal protein L5|Sch... 138 2e-34 SPAC3H5.12c |rpl501|rpl5-1, rpl5|60S ribosomal protein L5|Schizo... 138 2e-34 SPAC1687.20c |mis6||inner centromere protein Mis6|Schizosaccharo... 26 1.6 SPAC1006.03c |||human CCDC131 homolog|Schizosaccharomyces pombe|... 25 3.7 SPBC21.03c |||DUF55 family protein|Schizosaccharomyces pombe|chr... 24 4.8 SPAC16C9.06c |upf1||ATP-dependent RNA helicase Upf1|Schizosaccha... 24 4.8 SPCC1919.12c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|... 24 6.4 >SPBC11C11.09c |rpl502|rpl5-2, rpl5b|60S ribosomal protein L5|Schizosaccharomyces pombe|chr 2|||Manual Length = 294 Score = 138 bits (333), Expect = 2e-34 Identities = 59/89 (66%), Positives = 72/89 (80%) Frame = +2 Query: 53 MGFVKVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDV 232 M F+K VK+ YF RYQ K++RRREGKTDYYARKRL+ Q KNKYN PKYRL+VR SN+ V Sbjct: 1 MPFIKAVKSSPYFSRYQTKYRRRREGKTDYYARKRLIAQAKNKYNAPKYRLVVRFSNRFV 60 Query: 233 TCQVAYSRIEGDHIVCAAYSHELPRYGIK 319 TCQ+ SR+ GD+++ A+S ELPRYGIK Sbjct: 61 TCQIVSSRVNGDYVLAHAHSSELPRYGIK 89 >SPAC3H5.12c |rpl501|rpl5-1, rpl5|60S ribosomal protein L5|Schizosaccharomyces pombe|chr 1|||Manual Length = 294 Score = 138 bits (333), Expect = 2e-34 Identities = 59/89 (66%), Positives = 72/89 (80%) Frame = +2 Query: 53 MGFVKVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDV 232 M F+K VK+ YF RYQ K++RRREGKTDYYARKRL+ Q KNKYN PKYRL+VR SN+ V Sbjct: 1 MPFIKAVKSSPYFSRYQTKYRRRREGKTDYYARKRLIAQAKNKYNAPKYRLVVRFSNRFV 60 Query: 233 TCQVAYSRIEGDHIVCAAYSHELPRYGIK 319 TCQ+ SR+ GD+++ A+S ELPRYGIK Sbjct: 61 TCQIVSSRVNGDYVLAHAHSSELPRYGIK 89 >SPAC1687.20c |mis6||inner centromere protein Mis6|Schizosaccharomyces pombe|chr 1|||Manual Length = 672 Score = 25.8 bits (54), Expect = 1.6 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 234 VTSLLD-NRTISRYFGVLYLFLSWTTRR 154 V LD N + RY+GVL+ FL + T R Sbjct: 120 VYEFLDGNNLLCRYYGVLFHFLDFLTLR 147 >SPAC1006.03c |||human CCDC131 homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 714 Score = 24.6 bits (51), Expect = 3.7 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +2 Query: 68 VVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYN 187 + K + +YQ K + E T Y RK+ +++ + K N Sbjct: 485 IEKEEGELTKYQTLVKSKTEILTQLYTRKKQLLEQQGKGN 524 >SPBC21.03c |||DUF55 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 239 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 218 ITVQSVGTLECCICFYPGQRGVCEHSSQFFPHDAS 114 I + L C C +P +G+C+ S P D++ Sbjct: 62 IKIGDYAFLYCSNCKFPHIKGLCQICSNSHPDDSA 96 >SPAC16C9.06c |upf1||ATP-dependent RNA helicase Upf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 925 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/41 (26%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +2 Query: 77 NKQYFKRYQV--KFKRRREGKTDYYARKRLVVQDKNKYNTP 193 + Y + + V ++KRR TD+ + V D++K++ P Sbjct: 882 SSSYLEEWNVFAQYKRRESNATDFEDFRSQVGDDESKFDEP 922 >SPCC1919.12c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|||Manual Length = 843 Score = 23.8 bits (49), Expect = 6.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -3 Query: 224 YWITVQSVGTLECCI 180 YW+T+ + T CCI Sbjct: 487 YWVTLSYLCTFTCCI 501 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,344,606 Number of Sequences: 5004 Number of extensions: 24696 Number of successful extensions: 55 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 85983492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -