BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_I12 (319 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1659 + 38961637-38961639,38962361-38962433,38962531-389626... 127 2e-30 01_06_1660 + 38966999-38967001,38967685-38967757,38967841-389679... 125 9e-30 08_02_1410 - 26876243-26876497,26877129-26877239,26877240-268773... 28 1.8 12_02_1131 - 26358339-26360609 26 7.4 08_01_0200 + 1632883-1633913,1634620-1634677 26 7.4 10_08_1016 - 22262760-22264331 25 9.7 >01_06_1659 + 38961637-38961639,38962361-38962433,38962531-38962613, 38962732-38962858,38962950-38963029,38963112-38963228, 38963393-38963527,38963714-38963883,38963970-38964087 Length = 301 Score = 127 bits (307), Expect = 2e-30 Identities = 58/88 (65%), Positives = 69/88 (78%) Frame = +2 Query: 56 GFVKVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVT 235 GFVK K YFKR+QVKFKRRR+GKTDY AR RL QDKNKYNTPKYR + +NKD+T Sbjct: 3 GFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDIT 59 Query: 236 CQVAYSRIEGDHIVCAAYSHELPRYGIK 319 Q+ Y+ I GD ++ AAYSHELPRYG++ Sbjct: 60 AQIVYATIAGDIVMAAAYSHELPRYGLE 87 >01_06_1660 + 38966999-38967001,38967685-38967757,38967841-38967923, 38968042-38968168,38968260-38968339,38968428-38968544, 38968711-38968845,38969046-38969215,38969300-38969417 Length = 301 Score = 125 bits (301), Expect = 9e-30 Identities = 57/88 (64%), Positives = 68/88 (77%) Frame = +2 Query: 56 GFVKVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVT 235 GFVK K Y KR+QVKFKRRR+GKTDY AR RL QDKNKYNTPKYR + +NKD+T Sbjct: 3 GFVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDIT 59 Query: 236 CQVAYSRIEGDHIVCAAYSHELPRYGIK 319 Q+ Y+ I GD ++ AAYSHELPRYG++ Sbjct: 60 AQIVYATIAGDIVMAAAYSHELPRYGLE 87 >08_02_1410 - 26876243-26876497,26877129-26877239,26877240-26877324, 26877620-26877672,26878318-26878440,26878514-26878597, 26878708-26878773,26879512-26879584,26879854-26879888, 26879970-26880212 Length = 375 Score = 27.9 bits (59), Expect = 1.8 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +2 Query: 179 KYNTPKYRLIVRLSNKDVTCQVAYSRI--EGDHIVCAAYSHEL 301 +YNT +YR + +S K V C+ + + E DH+ A S L Sbjct: 274 RYNTSRYRELPHISIKCVFCKASVEPMGEESDHVHIIALSDAL 316 >12_02_1131 - 26358339-26360609 Length = 756 Score = 25.8 bits (54), Expect = 7.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 230 HLYWITVQSVGTLECCICF 174 HL+WIT +SVG + + F Sbjct: 221 HLHWITTKSVGDADAIMSF 239 >08_01_0200 + 1632883-1633913,1634620-1634677 Length = 362 Score = 25.8 bits (54), Expect = 7.4 Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Frame = -3 Query: 206 SVGTLECCICFYP-GQRG 156 +VG + CICFYP GQ G Sbjct: 33 TVGGYDWCICFYPEGQGG 50 >10_08_1016 - 22262760-22264331 Length = 523 Score = 25.4 bits (53), Expect = 9.7 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 221 WITVQSVGTLECCIC 177 ++ Q+VGT+ CCIC Sbjct: 15 FVPTQTVGTVLCCIC 29 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,286,296 Number of Sequences: 37544 Number of extensions: 145415 Number of successful extensions: 322 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 318 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 398975940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -