BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_I08 (399 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. 24 2.4 AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CY... 22 9.5 >AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. Length = 115 Score = 23.8 bits (49), Expect = 2.4 Identities = 22/65 (33%), Positives = 28/65 (43%) Frame = -2 Query: 200 VWIDHHNPVVYGRNVFCPERRAFP*TFCTETLCELCDICIFCSMFCAVWVRSPFLRLFST 21 VW+D VY ++ C R A TF E C LCD FC C R P +++ Sbjct: 31 VWVDRDK--VYCGHLDCT-RVA---TFKGERFCTLCDTRHFCE--CKE-TREPLPYMYAC 81 Query: 20 ATTYP 6 T P Sbjct: 82 PGTEP 86 >AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CYP4H24 protein. Length = 193 Score = 21.8 bits (44), Expect = 9.5 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = -2 Query: 200 VWIDHHNPVVY-GRNVFCPER 141 +++ H NPVVY F PER Sbjct: 95 IYVIHRNPVVYPDPERFDPER 115 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 365,248 Number of Sequences: 2352 Number of extensions: 7097 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31639662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -