BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_I07 (433 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase... 25 1.5 CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 23 6.1 >U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase protein. Length = 250 Score = 24.6 bits (51), Expect = 1.5 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = -1 Query: 280 LTPKHKNQRWLMRFDFDFF---NYLKFLWN 200 LTP HKN R L + FF ++ + LW+ Sbjct: 34 LTPAHKNARVLFAIEHMFFDEEDWRRVLWS 63 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 22.6 bits (46), Expect = 6.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 359 FNLIY*YRFYN*VYEIYQEQRFDYTPID 276 F ++ YR EI+ +FDY P+D Sbjct: 551 FKIVPSYRSAPPPVEIFVRAQFDYDPLD 578 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 415,133 Number of Sequences: 2352 Number of extensions: 8490 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35717724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -