BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_I02 (549 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) 37 0.009 SB_11394| Best HMM Match : GntR (HMM E-Value=7.9) 32 0.36 SB_3668| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_38173| Best HMM Match : PAN (HMM E-Value=0.0013) 29 2.5 SB_59148| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_8849| Best HMM Match : F-box (HMM E-Value=0.86) 28 4.4 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_12882| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) Length = 112 Score = 37.1 bits (82), Expect = 0.009 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 480 PFAFNACPLRRIPQRYVIGTST 545 PF N PLRRIPQ YVI TST Sbjct: 2 PFKINGVPLRRIPQSYVIATST 23 >SB_11394| Best HMM Match : GntR (HMM E-Value=7.9) Length = 451 Score = 31.9 bits (69), Expect = 0.36 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 421 LASVSCSLECC--RVVCYSSLDLLLSTRVPCAGFR 519 +A SC + CC RVVCYS + S RV C R Sbjct: 162 VACCSCRVACCSCRVVCYSCRVVCYSCRVACCSCR 196 Score = 31.5 bits (68), Expect = 0.47 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +1 Query: 433 SCSLECC--RVVCYSSLDLLLSTRVPCAGFR 519 SC + CC RVVCYS + S RV C R Sbjct: 124 SCRIACCSCRVVCYSCRVVFCSCRVACCSCR 154 Score = 31.1 bits (67), Expect = 0.62 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +1 Query: 433 SCSLECC--RVVCYSSLDLLLSTRVPCAGFR 519 SC + CC RVVCYS + S RV C R Sbjct: 187 SCRVACCSCRVVCYSCRVVFCSCRVACCSCR 217 Score = 30.7 bits (66), Expect = 0.82 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +1 Query: 394 CAFCWRADTLASVSCSLEC--CRVVCYSSLDLLLSTRVPCAGFRSA 525 C + + +A SC + C CRVVCYS S RV C R A Sbjct: 202 CRVVFCSCRVACCSCRVVCYSCRVVCYSCRVACCSCRVVCYSCRVA 247 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 433 SCSLECC--RVVCYSSLDLLLSTRVPCAGFR 519 SC + CC RVVCYS S RV C R Sbjct: 145 SCRVACCSCRVVCYSCRVACCSCRVACCSCR 175 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +1 Query: 421 LASVSCSLEC--CRVVCYSSLDLLLSTRVPCAGFR 519 +A SC + C CRVVCYS S RV C R Sbjct: 169 VACCSCRVVCYSCRVVCYSCRVACCSCRVVCYSCR 203 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +1 Query: 433 SCSLECC--RVVCYSSLDLLLSTRVPCAGFRSA 525 SC + CC RVVCYS S RV C R A Sbjct: 229 SCRVACCSCRVVCYSCRVACCSCRVVCYSCRVA 261 >SB_3668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = -2 Query: 221 WFLGLFSFRVLLTDKLIYSL-LVVHPAFGETEYTVSEVIIPRFANFLL-LDTAGCGCGGF 48 W+ + S ++ T LI++ L+ F + VSE ++PR+ F + T G G G F Sbjct: 359 WYRFIHSVWIVFT--LIFTAGLLAGAVFANSFVIVSETVLPRYKEFAMGFATIGMGAGTF 416 Query: 47 L 45 L Sbjct: 417 L 417 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 278 QDCTSASILFTAYLLNHDGWFLGLFSFRVLLTDKLI 171 +D T S+LFT YL D FL R+ L DK++ Sbjct: 1065 EDTTPTSLLFTVYLDYDDDKFLNDVKVRLGLVDKIV 1100 >SB_38173| Best HMM Match : PAN (HMM E-Value=0.0013) Length = 340 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -3 Query: 490 KAKGPVKSSRPLGNTPTSTTRLPACLPANRMHTVP 386 K+ P KS++P + PT+ T LP P R+ ++P Sbjct: 202 KSTKPTKSTKPTESKPTAPTSLPDQRPNCRLPSMP 236 >SB_59148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 28.7 bits (61), Expect = 3.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 379 SLPAQCAFCWRADTLASVSCSLECCRVVC 465 S+ QC W A S+S +++ C+ VC Sbjct: 127 SVEKQCVVRWLASVRTSISTAVDVCKAVC 155 >SB_8849| Best HMM Match : F-box (HMM E-Value=0.86) Length = 1222 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +2 Query: 410 GQTRWQ-ACRARWSVAEWSATLHWTFCFQRVSPAQDSAALC 529 G+ RW+ A + W + W + + C QRV D ALC Sbjct: 178 GEMRWKLALKRNWLYSNWKCVVCYRNCSQRVDSHFD-VALC 217 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -3 Query: 490 KAKGPVKSSRPLGNTPTSTTRLPACLPANRMHTVPG 383 + K PV +SR L N PT T + + H +PG Sbjct: 1009 RIKTPVPTSRLLLNVPTQNTAKSIIIQTYKKHALPG 1044 >SB_12882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 27.5 bits (58), Expect = 7.6 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = +1 Query: 325 VVLMARVSVNMCVGRDLTSL-PAQCAFCWRADTLASVSCSLECCRVVCYSSLDLLLSTRV 501 V+ +RV + +C R L P++ + SVSC C V+C S + ++L Sbjct: 83 VLCPSRVCIVLCPSRVCIVLCPSRVCIVLCPSRVVSVSCPYRVCIVLCPSCVCIVLCPSC 142 Query: 502 PC 507 C Sbjct: 143 VC 144 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,094,754 Number of Sequences: 59808 Number of extensions: 378205 Number of successful extensions: 1042 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1036 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -