BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_I01 (541 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283268-1|AAG15373.1| 46|Anopheles gambiae ribosomal protein ... 55 1e-09 AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 26 0.70 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 26 0.70 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 26 0.70 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 1.6 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 1.6 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 25 2.1 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 23 5.0 AF457556-1|AAL68786.1| 65|Anopheles gambiae salivary gland 7-l... 23 8.7 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 8.7 >AF283268-1|AAG15373.1| 46|Anopheles gambiae ribosomal protein S18 protein. Length = 46 Score = 55.2 bits (127), Expect = 1e-09 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +3 Query: 363 LREDLERLKKIRAHRGMRHYWGLRV 437 LREDLERLK+I AHRGMRHYWGLRV Sbjct: 1 LREDLERLKRIHAHRGMRHYWGLRV 25 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 26.2 bits (55), Expect = 0.70 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 301 LLRNQSGILYCLGFDMIVTIFSTSSSVHSPA 209 +LR+ SG+ + + F M V IF+ V SPA Sbjct: 93 VLRSMSGVFWLMIFLMFVAIFTIIMWVMSPA 123 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 26.2 bits (55), Expect = 0.70 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 301 LLRNQSGILYCLGFDMIVTIFSTSSSVHSPA 209 +LR+ SG+ + + F M V IF+ V SPA Sbjct: 93 VLRSMSGVFWLMIFLMFVAIFTIIMWVMSPA 123 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 26.2 bits (55), Expect = 0.70 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 301 LLRNQSGILYCLGFDMIVTIFSTSSSVHSPA 209 +LR+ SG+ + + F M V IF+ V SPA Sbjct: 93 VLRSMSGVFWLMIFLMFVAIFTIIMWVMSPA 123 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 25.0 bits (52), Expect = 1.6 Identities = 11/40 (27%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 162 YSNIVLKKADIDLDKRAGECTEEEV-EKIVTIMSNPRQYK 278 Y+ IVL +A + LDK +C + + +I+ + +Y+ Sbjct: 534 YAYIVLVQAVLPLDKNLNDCNRQSILGRIIRVTDEVIEYR 573 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.0 bits (52), Expect = 1.6 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = +3 Query: 36 IAKMSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVG 155 I S ++P+ F H+ R+ +++ + F+ T + G+G Sbjct: 102 IMARSKLLPNSFVHLARLKALSLEFCKIAKFSSTVLAGLG 141 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 24.6 bits (51), Expect = 2.1 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 Query: 301 LLRNQSGILYCLGFDMIVTIFSTSSSVHSPA 209 +L++ SG+ + + F M V IF+ V SPA Sbjct: 127 VLQSMSGVFWLMIFLMFVAIFTIIMWVMSPA 157 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 23.4 bits (48), Expect = 5.0 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +3 Query: 258 SNPRQYK-IPD-WFLNRQKDIVDG-KYSQLTSSNLDSKLREDLERLKKIRAHRG 410 SN + YK IP L K+ +G +Y +LT ++L ++ R+D L +I+ G Sbjct: 39 SNAKPYKAIPSPKLLAFAKEFKEGGRYYELTGADLFARWRQDYGDLIRIKGMFG 92 >AF457556-1|AAL68786.1| 65|Anopheles gambiae salivary gland 7-like protein protein. Length = 65 Score = 22.6 bits (46), Expect = 8.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 410 YASLLGSACPW 442 Y +LLG CPW Sbjct: 16 YQALLGLCCPW 26 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 22.6 bits (46), Expect = 8.7 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +1 Query: 310 ILLMANTAS*LLPI*TPSFVKIWKG 384 ILL+ ++ S +P+ P +K+W G Sbjct: 803 ILLVRHSQSDEVPVCEPGHLKLWDG 827 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 487,562 Number of Sequences: 2352 Number of extensions: 9249 Number of successful extensions: 38 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -