BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_H16 (540 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 32 0.014 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 26 0.70 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 25 1.2 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 25 1.2 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 25 2.1 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 2.8 AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 pr... 24 3.7 DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. 23 8.7 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 23 8.7 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 23 8.7 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 31.9 bits (69), Expect = 0.014 Identities = 30/111 (27%), Positives = 49/111 (44%), Gaps = 10/111 (9%) Frame = +3 Query: 78 VLFACVALAHGAMVRRDAPNTILQDLEKHA----QDFQKTISEQF------NAIVNSKNT 227 VL AL A RR N D E A DF ++ ++ NA+++ + Sbjct: 12 VLCCVFALTIAATPRRFLQNRFTVDYEPFAGPWNDDFDWSVIKEVLHKAPGNAVISPLSV 71 Query: 228 ESLNKALKEGSDSMVQQVSELSNSLQGALTDANGKAKEVLQQARQNLERTV 380 ++L L EGS S + EL +L G + A K ++ L Q +Q ++ + Sbjct: 72 KALLALLYEGSASRSETERELQQALSGGNSQAVPKLQDDLLQYKQQQQQNL 122 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 26.2 bits (55), Expect = 0.70 Identities = 10/43 (23%), Positives = 20/43 (46%) Frame = +3 Query: 285 ELSNSLQGALTDANGKAKEVLQQARQNLERTVEDLRKAHPDVE 413 E + D K +E +Q + +N+ +ED+ HP ++ Sbjct: 403 EFLRFISSTAPDGKAKYQEWVQDSCRNIVHVLEDIPSCHPPID 445 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 25.4 bits (53), Expect = 1.2 Identities = 23/85 (27%), Positives = 39/85 (45%) Frame = +3 Query: 192 EQFNAIVNSKNTESLNKALKEGSDSMVQQVSELSNSLQGALTDANGKAKEVLQQARQNLE 371 E+ + +N K + K+G S E +QG L N + K+ + + QN Sbjct: 359 EECSRELNLKEQKRKELYAKQGRGSQFSSKEERDKWIQGELKSLNKQIKDKI--SHQN-- 414 Query: 372 RTVEDLRKAHPDVEKQATALHEKLQ 446 + +DL+K D+ KQ L +K+Q Sbjct: 415 KLQDDLKK---DIAKQG-ELEKKIQ 435 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 25.4 bits (53), Expect = 1.2 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +3 Query: 393 KAHPDVEKQATALHEKLQTAIQ-NTLKESQNL 485 KAHPD+++ L K T I TL+ QN+ Sbjct: 350 KAHPDLQQSVDDLMAKFNTPIDGKTLQYFQNI 381 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 24.6 bits (51), Expect = 2.1 Identities = 16/59 (27%), Positives = 21/59 (35%) Frame = +2 Query: 338 GSAPTSSPELGAHSRGSPQGAPRRRETSHRITREAANRHPEHTKGEPEPGEGSRRQHGS 514 G A +S G + GSP G + H AA H H ++QH S Sbjct: 684 GGAGSSGGSGGGLASGSPYGGGGHHLSHHHGGAAAATGHHHHQHHAAPHHHSLQQQHAS 742 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 24.2 bits (50), Expect = 2.8 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 364 FWRACWSTSLALPFASVNAPCRLLDNSETCCTM 266 FWR CW L +++ RL + S CTM Sbjct: 758 FWRMCWE----LKSSTIVMMTRLEERSRIKCTM 786 >AY745224-1|AAU93491.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 23.8 bits (49), Expect = 3.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 486 PGSGSPLVCSGWRFAASRVMRWLV 415 P P +C G RFA ++V R +V Sbjct: 58 PFGDGPRMCLGMRFAVTQVRRAIV 81 >DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. Length = 264 Score = 22.6 bits (46), Expect = 8.7 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = +3 Query: 369 ERTVEDLRKAHPDVEKQATALHEKLQTAIQNTLKESQNLAKEVGVNMDQTSQK 527 ER ++ PD ++ K T ++ +KES LA G N+ + + K Sbjct: 95 ERVYREVMDVFPDPDQDIEVEDLKKLTYMERVIKESLRLAPS-GPNIARQTMK 146 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 22.6 bits (46), Expect = 8.7 Identities = 5/10 (50%), Positives = 9/10 (90%) Frame = +1 Query: 130 PLILYCKIWR 159 P ++YC++WR Sbjct: 98 PHVIYCRVWR 107 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 22.6 bits (46), Expect = 8.7 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = -1 Query: 531 PVSVRSDPC*RRLPS---PGSGSPLVCSGWRFAASRVMRWLVSRRR 403 P ++ C R P P P VC G RF +V LVS R Sbjct: 428 PDRFSAEACRNRTPYTFLPFGEGPRVCIGMRFGMMQVKVGLVSMVR 473 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 517,925 Number of Sequences: 2352 Number of extensions: 9366 Number of successful extensions: 30 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -