BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_H12 (312 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 38 3e-05 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 1.7 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 21 3.0 S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 20 6.9 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 37.5 bits (83), Expect = 3e-05 Identities = 26/69 (37%), Positives = 37/69 (53%), Gaps = 6/69 (8%) Frame = +3 Query: 33 TDTAVKMMKEGTMSED--DFIEEAKVMTKL-QHQNLVQLYGVCSKHR---PIYIVTEFMR 194 T AVKM+KE SE+ F +E +M + QH +V L G ++ R P+ +V E+ Sbjct: 478 TQVAVKMLKESPTSEEIRQFTQEINIMKSVRQHPYIVSLIGCVTEGRAEGPL-LVVEYCS 536 Query: 195 YGSLFNYLR 221 G L YLR Sbjct: 537 RGDLQTYLR 545 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 1.7 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -3 Query: 166 GRCFEQTPYNCTRFWCCN 113 GR F NC +++ CN Sbjct: 2239 GRLFVADDTNCAQYYLCN 2256 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.0 bits (42), Expect = 3.0 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = -3 Query: 139 NCTRFWCC 116 +CTR+W C Sbjct: 111 SCTRYWTC 118 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 19.8 bits (39), Expect = 6.9 Identities = 5/12 (41%), Positives = 9/12 (75%) Frame = -3 Query: 190 INSVTMYIGRCF 155 + S+ +Y+G CF Sbjct: 127 VKSIDVYLGTCF 138 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,040 Number of Sequences: 336 Number of extensions: 1328 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5730534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -