BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_H11 (463 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1758 - 39681942-39682030,39682115-39682345,39682643-396826... 74 5e-14 11_06_0767 + 27121761-27123335,27123701-27123910,27124843-271249... 70 8e-13 01_01_0682 - 5244805-5244919,5246468-5246613,5246813-5246994,524... 70 8e-13 01_01_0509 - 3713109-3713244,3713689-3713733,3713959-3714015,371... 69 2e-12 01_05_0292 + 20518668-20519090,20519213-20519281,20520204-205204... 64 7e-11 07_02_0023 - 11918735-11918827,11919139-11919231,11919320-119194... 63 9e-11 11_06_0300 + 22095396-22096145,22096261-22096344,22097062-220973... 55 3e-08 07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398,553... 54 4e-08 08_01_0397 - 3509186-3510291,3510322-3512335 54 6e-08 06_03_0674 + 23422004-23422552,23423295-23423369,23424360-234244... 53 1e-07 03_06_0365 - 33399422-33399925,33400470-33400583,33400762-334009... 52 3e-07 08_01_0353 - 3107628-3107774,3108177-3108213,3108248-3109164,310... 50 7e-07 03_05_0865 - 28365430-28367640 42 2e-04 06_03_1255 + 28780181-28781172,28782065-28782932 38 0.003 09_03_0167 + 12965030-12965356,12966100-12966387,12966704-129668... 37 0.009 07_03_1500 + 27001842-27002058,27002144-27002283,27002458-270025... 36 0.016 03_05_0997 + 29565311-29565664,29566134-29566298,29566572-295666... 36 0.016 06_03_1284 - 28988287-28988922,28989335-28989765,28989850-289899... 35 0.028 03_06_0531 + 34552206-34552598,34552665-34552735,34553363-345533... 35 0.028 02_01_0355 + 2558792-2558862,2558993-2559099,2559185-2559615,256... 35 0.028 07_03_1392 - 26238885-26239007,26239137-26239235,26239636-262397... 34 0.048 05_01_0079 + 531617-531734,531987-532059,532152-532261,532400-53... 33 0.085 02_01_0765 - 5694535-5694644,5695039-5696550,5697229-5697390,569... 33 0.15 01_05_0296 + 20567259-20567386,20568895-20569123,20569205-205694... 33 0.15 01_05_0295 + 20537147-20537291,20539111-20539283,20539365-205395... 33 0.15 03_06_0344 - 33276366-33276548,33277044-33277169,33277254-332773... 32 0.20 03_02_0758 + 10954268-10954841,10955988-10957145,10957176-109572... 32 0.20 03_05_0052 - 20293197-20293310,20293938-20294024,20294133-202942... 32 0.26 01_06_0020 + 25630728-25631023,25631308-25631548,25631629-256317... 32 0.26 08_02_0671 - 19890187-19890295,19891186-19891320,19891551-198919... 31 0.34 07_03_0601 - 19872780-19873099,19873148-19873151,19874196-198743... 31 0.34 06_03_0337 + 19678152-19678484,19678616-19678801,19679232-196794... 31 0.34 09_05_0008 + 20042390-20042845,20043323-20043457,20043539-200436... 31 0.45 06_03_0287 - 19168685-19168735,19168847-19168884,19169517-191697... 31 0.45 07_01_0322 - 2258067-2258519,2258620-2258781,2258896-2259159,225... 30 0.79 02_05_1293 - 35520733-35520963,35521696-35521878,35522040-355222... 30 1.0 01_05_0722 + 24598426-24598649,24599113-24599219,24599319-245993... 30 1.0 12_02_1076 - 25862671-25863159,25863290-25863451,25863614-258638... 29 1.4 12_02_0340 - 17725866-17725884,17726046-17726326,17726842-177269... 29 1.4 07_03_1566 + 27766336-27766393,27766480-27766609,27766728-277667... 29 1.4 03_05_0619 - 26180980-26181105,26181329-26181417,26181518-261816... 29 1.4 01_05_0721 + 24594815-24594834,24595207-24595313,24595417-245954... 29 1.4 01_01_0602 - 4484972-4485450,4485949-4485997,4486108-4486237,448... 29 2.4 11_05_0063 - 18756289-18756390,18756769-18756954,18757053-187572... 27 5.6 03_02_0189 - 6253659-6255380 27 5.6 02_05_0064 - 25529630-25531440,25531663-25531673,25533113-255331... 27 5.6 03_01_0399 + 3097878-3098141,3098254-3098547,3098659-3098886,309... 27 7.3 02_05_1067 - 33858215-33858321,33858422-33858527,33859014-338592... 27 7.3 07_01_0857 - 7127681-7127830,7128896-7129414 27 9.7 03_05_0429 - 24157060-24157671,24158000-24158468,24158679-241587... 27 9.7 >01_06_1758 - 39681942-39682030,39682115-39682345,39682643-39682679, 39683604-39683835,39683937-39684022,39684126-39684218, 39684302-39684465,39684541-39684702,39684783-39684962, 39685079-39685515,39685614-39685669 Length = 588 Score = 74.1 bits (174), Expect = 5e-14 Identities = 31/53 (58%), Positives = 45/53 (84%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSMA 173 EDYIHRIGRTGR+ A GT++ FFT SN++ +++LV +L+EA Q+++P L+SMA Sbjct: 500 EDYIHRIGRTGRAGASGTAFTFFTLSNAKFSRNLVKILREAGQVVNPALESMA 552 >11_06_0767 + 27121761-27123335,27123701-27123910,27124843-27124911, 27125387-27125656,27126027-27126377,27126480-27126757, 27126887-27128330 Length = 1398 Score = 70.1 bits (164), Expect = 8e-13 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = +3 Query: 9 GSEDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSMA 173 G EDY+HRIGRTGR+ A G SY FF+ + + A DLV VL+ ANQ + P+LQ MA Sbjct: 928 GIEDYVHRIGRTGRAGATGVSYTFFSEQDWKYAGDLVKVLEGANQHVPPELQEMA 982 >01_01_0682 - 5244805-5244919,5246468-5246613,5246813-5246994, 5247069-5247295,5247382-5247467,5247564-5247656, 5247964-5248118,5248407-5248490,5248589-5248768, 5249587-5249828,5249927-5249982 Length = 521 Score = 70.1 bits (164), Expect = 8e-13 Identities = 29/43 (67%), Positives = 38/43 (88%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQ 143 EDY+HRIGRTGR+ AKGT+Y FFT +N+R AKDL+++L+EA Q Sbjct: 392 EDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQ 434 >01_01_0509 - 3713109-3713244,3713689-3713733,3713959-3714015, 3714088-3714438,3714585-3714862,3714939-3715289, 3715378-3715647,3716035-3716103,3716194-3716304, 3716503-3716583,3716825-3716914,3717032-3717262 Length = 689 Score = 68.5 bits (160), Expect = 2e-12 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = +3 Query: 9 GSEDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSM 170 G EDY+HRIGRTGR+ A G +Y FF +S+ A DLV +L+ ANQ +S QL+ M Sbjct: 504 GVEDYVHRIGRTGRAGATGVAYTFFCDQDSKYASDLVKILEGANQSVSQQLRDM 557 >01_05_0292 + 20518668-20519090,20519213-20519281,20520204-20520473, 20520734-20521084,20521251-20521528,20522755-20523099, 20523346-20523911,20525155-20525528 Length = 891 Score = 63.7 bits (148), Expect = 7e-11 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = +3 Query: 9 GSEDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSMA 173 G EDY+HRIGRTGR+ A G +Y FF +S+ A DL+ +L+ ANQ + L MA Sbjct: 474 GIEDYVHRIGRTGRAGATGVAYTFFCDQDSKYAADLIKILEGANQRVPRDLADMA 528 >07_02_0023 - 11918735-11918827,11919139-11919231,11919320-11919484, 11920234-11920327,11921012-11921136,11921228-11921313, 11921786-11921864,11923777-11923857,11924153-11924260, 11924870-11924994,11925110-11925530 Length = 489 Score = 63.3 bits (147), Expect = 9e-11 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = +3 Query: 12 SEDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQL 161 +EDY+HRIGRTGR+ KG ++ FFT N A +LV+VL+EA Q++ P L Sbjct: 400 TEDYVHRIGRTGRAGKKGVAHTFFTQENKGLAGELVNVLREAGQVVPPAL 449 >11_06_0300 + 22095396-22096145,22096261-22096344,22097062-22097304, 22098535-22098702,22098895-22099008,22099378-22099890 Length = 623 Score = 54.8 bits (126), Expect = 3e-08 Identities = 24/53 (45%), Positives = 34/53 (64%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSMA 173 +DY+HRIGRTGR+ G + AFF +NS A+ L ++QE+NQ + L A Sbjct: 498 DDYVHRIGRTGRAGKSGLATAFFNENNSSMARSLAELMQESNQEVPAWLSRYA 550 >07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398, 5534564-5534731,5535951-5536193,5537178-5537261, 5537357-5538117,5539637-5539730,5540633-5540899, 5541311-5541316,5542538-5542657 Length = 801 Score = 54.4 bits (125), Expect = 4e-08 Identities = 25/53 (47%), Positives = 35/53 (66%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSMA 173 +DY+HRIGRTGR+ G + AFF SN+ A+ L ++QEANQ + L+ A Sbjct: 673 DDYVHRIGRTGRAGKSGLATAFFNESNTPLARPLSELMQEANQEVPQWLERYA 725 >08_01_0397 - 3509186-3510291,3510322-3512335 Length = 1039 Score = 54.0 bits (124), Expect = 6e-08 Identities = 23/54 (42%), Positives = 33/54 (61%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSMAD 176 EDY+HR+GRTGR+ KG + F + R A DLV L+ + Q + L+ +AD Sbjct: 743 EDYVHRVGRTGRAGRKGFAVTFISEEEERYAPDLVKALELSEQAVPEDLKGLAD 796 >06_03_0674 + 23422004-23422552,23423295-23423369,23424360-23424443, 23424749-23424991,23425348-23425515,23425608-23425727, 23426372-23427016 Length = 627 Score = 52.8 bits (121), Expect = 1e-07 Identities = 25/54 (46%), Positives = 35/54 (64%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSMAD 176 EDY+HRIGRTGR+ G++ AFFT S+ AK L+ ++ EA Q + L A+ Sbjct: 458 EDYVHRIGRTGRAGKAGSATAFFTESDHSLAKGLLELMTEAKQDVPDWLVQYAE 511 >03_06_0365 - 33399422-33399925,33400470-33400583,33400762-33400929, 33401305-33401547,33402148-33402231,33402323-33403098, 33404423-33404636 Length = 700 Score = 51.6 bits (118), Expect = 3e-07 Identities = 23/50 (46%), Positives = 32/50 (64%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQ 164 +DY+HRIGRTGR+ G + AFF N A+ L ++QEANQ + L+ Sbjct: 578 DDYVHRIGRTGRAGKSGLATAFFNEGNLSLARPLCELMQEANQEVPQWLE 627 >08_01_0353 - 3107628-3107774,3108177-3108213,3108248-3109164, 3109210-3110952 Length = 947 Score = 50.4 bits (115), Expect = 7e-07 Identities = 21/54 (38%), Positives = 31/54 (57%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSMAD 176 EDY+HR+GRTG + KG + F + R A DL L+ + Q + L+ +AD Sbjct: 595 EDYVHRVGRTGHAGRKGFAVTFISDEEERYAPDLAKALELSEQAVPQDLKGLAD 648 >03_05_0865 - 28365430-28367640 Length = 736 Score = 42.3 bits (95), Expect = 2e-04 Identities = 20/49 (40%), Positives = 30/49 (61%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQL 161 + Y HRIGRTGR+ KG + +F T N+ DL +L ++N + P+L Sbjct: 660 DTYTHRIGRTGRAGKKGLATSFLTLENTDIFFDLKQMLIQSNSPVPPEL 708 >06_03_1255 + 28780181-28781172,28782065-28782932 Length = 619 Score = 38.3 bits (85), Expect = 0.003 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQA-KDLVSVLQEANQIISPQLQSMAD 176 E+Y+HRIGRTGR G + F + + DL +L E+ Q + P L + D Sbjct: 506 ENYVHRIGRTGRRGKTGVATTFINKNQTETTLLDLKQLLIESKQRLPPILADLDD 560 >09_03_0167 + 12965030-12965356,12966100-12966387,12966704-12966826, 12967229-12967611,12967863-12968190,12968324-12968353, 12968837-12968989,12969510-12969815 Length = 645 Score = 36.7 bits (81), Expect = 0.009 Identities = 16/50 (32%), Positives = 30/50 (60%) Frame = +3 Query: 18 DYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQS 167 D++HR+GRT R+ G + +T +N +DLV +++A ++ P Q+ Sbjct: 502 DFLHRVGRTARAGQSGIVTSLYTEAN----RDLVRAVRQAEELAQPVYQT 547 >07_03_1500 + 27001842-27002058,27002144-27002283,27002458-27002549, 27002680-27002776,27002871-27002951,27003031-27003263, 27003876-27004070,27004149-27004239,27004324-27004446, 27004542-27004692,27005060-27005262 Length = 540 Score = 35.9 bits (79), Expect = 0.016 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 21 YIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVL 128 YIHRIGR+GR+ G + FFT + +++ +VL Sbjct: 469 YIHRIGRSGRAGRSGEAITFFTEEDKPFLRNIANVL 504 >03_05_0997 + 29565311-29565664,29566134-29566298,29566572-29566661, 29566763-29566891,29568141-29568272,29568904-29568969, 29569326-29569505,29569664-29569693,29569744-29569839, 29569959-29570096,29571060-29571142,29571447-29571484, 29571568-29571788,29572491-29572538 Length = 589 Score = 35.9 bits (79), Expect = 0.016 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +3 Query: 21 YIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQE 134 Y+HR+GRTGR+ G S + +P + +D+ ++L++ Sbjct: 395 YVHRVGRTGRANKTGASISLVSPKENGIFEDIENMLKD 432 >06_03_1284 - 28988287-28988922,28989335-28989765,28989850-28989956, 28990066-28990136 Length = 414 Score = 35.1 bits (77), Expect = 0.028 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDL 116 E+Y+HRIGR+GR KG + F T + R D+ Sbjct: 362 ENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDI 395 >03_06_0531 + 34552206-34552598,34552665-34552735,34553363-34553369, 34553603-34553736,34553834-34554245,34554655-34554753, 34555059-34555283,34555652-34556029,34556412-34556555, 34556832-34556927,34557228-34557547,34557965-34558040 Length = 784 Score = 35.1 bits (77), Expect = 0.028 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDL 116 E ++HR GRTGR+ GT+ FT S R + L Sbjct: 458 ETFVHRSGRTGRAGKAGTAILMFTNSQRRTVRSL 491 >02_01_0355 + 2558792-2558862,2558993-2559099,2559185-2559615, 2560100-2560735 Length = 414 Score = 35.1 bits (77), Expect = 0.028 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDL 116 E+Y+HRIGR+GR KG + F T + R D+ Sbjct: 362 ENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDI 395 >07_03_1392 - 26238885-26239007,26239137-26239235,26239636-26239720, 26239825-26240028,26240360-26240682,26241904-26242575 Length = 501 Score = 34.3 bits (75), Expect = 0.048 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +3 Query: 6 RGSEDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQL 161 R DYIHR+GRT R+ G S +F T + +L E ++ QL Sbjct: 400 RYPRDYIHRVGRTARATRGGLSISFITTQRD------IRLLHEIEDVVGKQL 445 >05_01_0079 + 531617-531734,531987-532059,532152-532261,532400-532543, 532628-532736,532836-533182,533260-533333,533478-533782, 534168-534294,534385-534414,534589-534837 Length = 561 Score = 33.5 bits (73), Expect = 0.085 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 12 SEDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDL 116 + +Y+HR+GRT R KG + F P + +DL Sbjct: 421 ASEYVHRVGRTARIGEKGEALLFLQPIETDYLRDL 455 >02_01_0765 - 5694535-5694644,5695039-5696550,5697229-5697390, 5698015-5698057 Length = 608 Score = 32.7 bits (71), Expect = 0.15 Identities = 13/49 (26%), Positives = 26/49 (53%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQL 161 ++Y+H++GR R +G + F + ++LV +L+ A I +L Sbjct: 511 DEYVHQVGRASRMGVEGMAIVFVNEEDRNLFRELVQILKTAGAPIPREL 559 >01_05_0296 + 20567259-20567386,20568895-20569123,20569205-20569436, 20569583-20569701,20570321-20570377,20570455-20570639, 20571416-20571560,20571630-20571713,20571798-20571861, 20571889-20571932 Length = 428 Score = 32.7 bits (71), Expect = 0.15 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = +3 Query: 12 SEDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSMAD 176 ++ Y+HR+GR GR KG + F +S D+++ +QE ++ +L D Sbjct: 359 ADSYLHRVGRAGRFGTKGLAITFV---SSASDSDVLNQVQERFEVDIKELPEQID 410 >01_05_0295 + 20537147-20537291,20539111-20539283,20539365-20539596, 20539743-20539861,20540480-20540536,20540615-20540799, 20542252-20542396,20542463-20542546,20542634-20542697, 20542799-20542809 Length = 404 Score = 32.7 bits (71), Expect = 0.15 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = +3 Query: 12 SEDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSMAD 176 ++ Y+HR+GR GR KG + F +S D+++ +QE ++ +L D Sbjct: 346 ADSYLHRVGRAGRFGTKGLAITFV---SSASDSDVLNQVQERFEVDIKELPEQID 397 >03_06_0344 - 33276366-33276548,33277044-33277169,33277254-33277322, 33277401-33277505,33277595-33277633,33277717-33278016, 33278093-33278182,33278271-33278312,33278433-33278516, 33278762-33278947,33279218-33279403,33279663-33280025 Length = 590 Score = 32.3 bits (70), Expect = 0.20 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +3 Query: 15 EDYIHRIGRTGR-SKAKGTSYAFFTP 89 +DYIHR+GRT R K KG + F P Sbjct: 430 KDYIHRVGRTARGEKGKGEALLFLLP 455 >03_02_0758 + 10954268-10954841,10955988-10957145,10957176-10957216, 10957412-10957448,10957534-10957954,10958201-10958234 Length = 754 Score = 32.3 bits (70), Expect = 0.20 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +3 Query: 3 ARGSEDYIHRIGRTGRSKAK-GTSYAFFTPSNSRQA 107 A+ + +IHRIGRTGR+ K GT+Y T R A Sbjct: 542 AKEMDMHIHRIGRTGRAGDKDGTAYTLITQKEVRFA 577 >03_05_0052 - 20293197-20293310,20293938-20294024,20294133-20294270, 20295009-20295128,20295236-20295343,20296053-20296133, 20296216-20296456,20297010-20297305 Length = 394 Score = 31.9 bits (69), Expect = 0.26 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDL 116 E YIHRIGR+GR KG + F + R +D+ Sbjct: 342 ELYIHRIGRSGRFGRKGVAINFVKKEDIRILRDI 375 >01_06_0020 + 25630728-25631023,25631308-25631548,25631629-25631709, 25632109-25632216,25632329-25632448,25632806-25632943, 25633064-25633150,25633802-25633915 Length = 394 Score = 31.9 bits (69), Expect = 0.26 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDL 116 E YIHRIGR+GR KG + F + R +D+ Sbjct: 342 ELYIHRIGRSGRFGRKGVAINFVKKEDIRILRDI 375 >08_02_0671 - 19890187-19890295,19891186-19891320,19891551-19891917, 19892909-19893044,19894924-19894974,19895053-19895134, 19895801-19895853,19895989-19896065,19896234-19896273, 19897666-19897767,19897989-19898031,19898127-19899288, 19899902-19900271 Length = 908 Score = 31.5 bits (68), Expect = 0.34 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 21 YIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDL 116 ++HR+GR R GT+Y F T + DL Sbjct: 353 FVHRVGRVARQGRSGTAYTFVTSEDMAYLLDL 384 >07_03_0601 - 19872780-19873099,19873148-19873151,19874196-19874357, 19874429-19874617,19874687-19875010,19875103-19875378, 19875436-19875478,19876110-19876188,19876473-19876555, 19876708-19876782,19877324-19877490,19877960-19878370 Length = 710 Score = 31.5 bits (68), Expect = 0.34 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 21 YIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDL 116 YIHR+GRT R +G + F P + + L Sbjct: 559 YIHRVGRTARYNKRGKALIFLCPEEEKMLEKL 590 >06_03_0337 + 19678152-19678484,19678616-19678801,19679232-19679417, 19680840-19680926,19681045-19681086,19681164-19681253, 19681399-19681503,19681797-19681835,19681914-19682018, 19682463-19682531,19682587-19682736,19683156-19683335 Length = 523 Score = 31.5 bits (68), Expect = 0.34 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 12 SEDYIHRIGRTGR-SKAKGTSYAFFTP 89 ++DYIHR+GRT R KG++ F P Sbjct: 355 TKDYIHRVGRTARGDNGKGSAILFLLP 381 >09_05_0008 + 20042390-20042845,20043323-20043457,20043539-20043679, 20043771-20043882,20044084-20044154,20044251-20044405, 20044484-20044595,20044932-20045033,20045116-20045176, 20045251-20045422,20045512-20045608,20045692-20045786, 20045881-20046014,20046208-20046422 Length = 685 Score = 31.1 bits (67), Expect = 0.45 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 6 RGSEDYIHRIGRTGRSKAKGTSYAFFTP 89 R E YIHR GRTGR+ G + F P Sbjct: 433 RDVEAYIHRSGRTGRAGNTGVAVMLFEP 460 >06_03_0287 - 19168685-19168735,19168847-19168884,19169517-19169727, 19171461-19171643,19171879-19172028,19172161-19172256, 19172378-19172464,19172535-19172741,19172823-19173047, 19173150-19173261,19173397-19173453,19175522-19176882 Length = 925 Score = 31.1 bits (67), Expect = 0.45 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNS---RQAKDL 116 E YIHR+GRTGR +G+ P R KDL Sbjct: 773 EQYIHRLGRTGRRGNEGSGILLLAPWEEYFLRSIKDL 809 >07_01_0322 - 2258067-2258519,2258620-2258781,2258896-2259159, 2259196-2259294,2259723-2260131,2260223-2260350, 2261115-2261181,2262766-2262838,2262911-2263130 Length = 624 Score = 30.3 bits (65), Expect = 0.79 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 12 SEDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAK 110 SE ++HR GRT R+ KG++ +T +R + Sbjct: 430 SELFVHRSGRTARAGKKGSAILIYTNDQARAVR 462 >02_05_1293 - 35520733-35520963,35521696-35521878,35522040-35522255, 35522936-35523022,35523125-35523331,35523426-35523650, 35523743-35523798,35524009-35524115,35524443-35525470 Length = 779 Score = 29.9 bits (64), Expect = 1.0 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTP 89 E YIHR+GRTGR G P Sbjct: 650 EHYIHRLGRTGREGKSGKGILLLAP 674 >01_05_0722 + 24598426-24598649,24599113-24599219,24599319-24599374, 24599469-24599675,24599757-24599963,24600037-24600123, 24600167-24600208,24600209-24600304,24600406-24600621, 24600693-24600875,24601014-24601241 Length = 550 Score = 29.9 bits (64), Expect = 1.0 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTP 89 E YIHR+GRTGR G P Sbjct: 422 EQYIHRLGRTGRKGKDGLGLLLLAP 446 >12_02_1076 - 25862671-25863159,25863290-25863451,25863614-25863838, 25863939-25864037,25864584-25864992,25865094-25865221, 25865955-25866329 Length = 628 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 12 SEDYIHRIGRTGRSKAKGTSYAFFTPSNSR 101 SE ++HR GRTGR+ KG + + SR Sbjct: 422 SELFVHRSGRTGRAGKKGKAIVMHSYQQSR 451 >12_02_0340 - 17725866-17725884,17726046-17726326,17726842-17726928, 17727018-17727113,17728484-17728585,17728720-17728762, 17728834-17728952,17729348-17729444,17730153-17730214, 17730370-17730432,17730847-17730949,17731402-17731497, 17731594-17731742,17732356-17732529,17733078-17733156, 17733807-17733913,17733994-17734062,17734879-17735043, 17735206-17735703 Length = 802 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 6 RGSEDYIHRIGRTGRSKAKGTSYAFFT 86 R + Y+HR+GRT R+ +G + F T Sbjct: 518 RDARTYLHRVGRTARAGREGYAVTFVT 544 >07_03_1566 + 27766336-27766393,27766480-27766609,27766728-27766797, 27767134-27767196,27767741-27767815,27768035-27768154, 27768508-27768549,27768651-27768725,27768909-27769055, 27769165-27769302,27769448-27769562,27769658-27769746, 27770062-27770184 Length = 414 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 Query: 12 SEDYIHRIGRTGRSKAKG 65 S+DYIHR+GRT R+ G Sbjct: 305 SKDYIHRVGRTARAGQSG 322 >03_05_0619 - 26180980-26181105,26181329-26181417,26181518-26181629, 26181711-26181848,26182004-26182150,26182458-26182532, 26182627-26182668,26183033-26183152,26183806-26183880, 26184051-26184113,26184690-26184759,26184877-26185006, 26185097-26185328 Length = 472 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +3 Query: 12 SEDYIHRIGRTGRSKAKGTSYA 77 S+DY+HR+GRT R A T YA Sbjct: 363 SKDYVHRVGRTAR--AGNTGYA 382 >01_05_0721 + 24594815-24594834,24595207-24595313,24595417-24595472, 24595562-24595810,24595871-24596077,24596157-24596243, 24596331-24596426,24596500-24596715,24596908-24597090, 24597222-24597449 Length = 482 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTP 89 + YIHR+GRTGR +G P Sbjct: 354 QQYIHRLGRTGRKGKEGQGLLLLAP 378 >01_01_0602 - 4484972-4485450,4485949-4485997,4486108-4486237, 4486636-4486778,4486819-4486877,4487167-4487200, 4487489-4487629,4487719-4487907,4488027-4488122, 4488163-4488225,4488588-4489097 Length = 630 Score = 28.7 bits (61), Expect = 2.4 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +3 Query: 12 SEDYIHRIGRTGRSKAKG 65 S DY+HR GRT R AKG Sbjct: 455 SIDYLHRTGRTARMGAKG 472 >11_05_0063 - 18756289-18756390,18756769-18756954,18757053-18757223, 18757339-18757383,18758087-18758260,18758801-18758887, 18759349-18759510,18759945-18760015,18760296-18760435, 18760828-18760952,18761329-18761463,18762069-18762314, 18762530-18762755,18763039-18763091 Length = 640 Score = 27.5 bits (58), Expect = 5.6 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +3 Query: 36 GRTGRSKAKGTSYAFFTPSN--SRQAKDLVSVLQEANQI 146 GR GRS +G +Y F+T + S+ A D + ++E + + Sbjct: 389 GRVGRSGTEGFAYLFYTDKSLLSKIATDRLGAIEEHSDL 427 >03_02_0189 - 6253659-6255380 Length = 573 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 12 SEDYIHRIGRTGRSKAKGT 68 S Y HR GRTGR KGT Sbjct: 512 STHYAHRAGRTGRLGRKGT 530 >02_05_0064 - 25529630-25531440,25531663-25531673,25533113-25533198, 25533412-25534259,25535385-25535736 Length = 1035 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 12 SEDYIHRIGRTGRSKAKGT 68 S Y HR GRTGR KGT Sbjct: 974 STHYAHRAGRTGRLGRKGT 992 >03_01_0399 + 3097878-3098141,3098254-3098547,3098659-3098886, 3099148-3099224,3099501-3099540,3099737-3099802, 3100305-3100706,3100777-3100888,3101445-3101530, 3101607-3101672 Length = 544 Score = 27.1 bits (57), Expect = 7.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSY 74 E Y+HRIGR GR KG + Sbjct: 479 EVYLHRIGRAGRFGRKGAVF 498 >02_05_1067 - 33858215-33858321,33858422-33858527,33859014-33859218, 33859463-33859650,33859780-33859957,33860201-33860298, 33860619-33860873,33861002-33861236,33861846-33861973 Length = 499 Score = 27.1 bits (57), Expect = 7.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 21 YIHRIGRTGRSKAKGTSYAF 80 YIHR GRT R+ G+ + F Sbjct: 405 YIHRAGRTARAGESGSCFTF 424 >07_01_0857 - 7127681-7127830,7128896-7129414 Length = 222 Score = 26.6 bits (56), Expect = 9.7 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 4/33 (12%) Frame = +2 Query: 152 PSVAING*PQR---RWRRWMEQKQIW-RRTWRW 238 P VA++ P+R RWRR + Q W RR WR+ Sbjct: 99 PGVAVHLRPRRWDWRWRRCHWRPQRWRRRRWRF 131 >03_05_0429 - 24157060-24157671,24158000-24158468,24158679-24158752, 24159231-24159280,24159368-24159449,24159526-24159575, 24159666-24159708,24159804-24159884,24159988-24160033, 24160151-24160197,24160358-24160423,24160701-24160767, 24160913-24160998 Length = 590 Score = 26.6 bits (56), Expect = 9.7 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 16 RITFIELVGQEDPKLKELHMHSLPHPTPAKLKISSPFYK 132 RI L EDP +LH P PTP I K Sbjct: 443 RIAEFPLASSEDPPFLKLHGRRSPTPTPQHCVIDQSITK 481 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,494,774 Number of Sequences: 37544 Number of extensions: 147616 Number of successful extensions: 533 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 531 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 919380308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -