BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_H11 (463 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 77 5e-15 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-08 SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 40 8e-04 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 34 0.050 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 33 0.11 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 33 0.15 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 31 0.61 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.81 SB_1215| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.81 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 29 1.9 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 29 1.9 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 29 2.5 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 28 3.3 SB_58021| Best HMM Match : Helicase_C (HMM E-Value=0.017) 28 3.3 SB_24297| Best HMM Match : Helicase_C (HMM E-Value=0.017) 28 3.3 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 28 3.3 SB_11973| Best HMM Match : Cupin_1 (HMM E-Value=3.4) 28 3.3 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 28 3.3 SB_37956| Best HMM Match : Helicase_C (HMM E-Value=1.5e-27) 28 4.3 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 77.4 bits (182), Expect = 5e-15 Identities = 34/55 (61%), Positives = 45/55 (81%) Frame = +3 Query: 12 SEDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSMAD 176 +EDY+HRIGRT RS GTSY FFT +N++QAK+LVSVLQEA Q ++P+L ++ D Sbjct: 367 TEDYVHRIGRTARSDRTGTSYTFFTVNNAKQAKELVSVLQEAKQHVNPKLLNLQD 421 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 54.4 bits (125), Expect = 4e-08 Identities = 25/53 (47%), Positives = 35/53 (66%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSMA 173 E+Y+HRIGRTGR G + +FF N AK+L+ +L+E+ Q I L+SMA Sbjct: 1182 EEYVHRIGRTGRVGHTGLATSFFNHKNKNVAKELMDILEESKQEIPSWLESMA 1234 >SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 53.2 bits (122), Expect = 1e-07 Identities = 24/56 (42%), Positives = 34/56 (60%) Frame = +3 Query: 6 RGSEDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQSMA 173 R EDY+HR+GRTGR+ GTS F + + R A L+ ++ +ANQ + L MA Sbjct: 121 RHIEDYVHRVGRTGRAGRSGTSLTFISREDWRSAHKLIKIMVQANQEVPDFLHDMA 176 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 48.4 bits (110), Expect = 3e-06 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPS-NSRQAKDLVSVLQEANQIISPQLQSMAD 176 ++Y+HRIGRTGR KG + FF + + A+ LV VL EANQ + L+ +A+ Sbjct: 1044 DEYVHRIGRTGRIGNKGKATTFFLRGRDDKVARGLVKVLSEANQEVPEWLEEIAE 1098 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 40.3 bits (90), Expect = 8e-04 Identities = 20/42 (47%), Positives = 26/42 (61%) Frame = +3 Query: 3 ARGSEDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVL 128 A+ EDY HRIGRTGR+ G + +F T S+S DL +L Sbjct: 362 AKTIEDYTHRIGRTGRAGKTGIAVSFLTQSDSGVFYDLKQLL 403 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 34.3 bits (75), Expect = 0.050 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFT 86 EDYIHR+GRT R+ G S F T Sbjct: 127 EDYIHRVGRTARAGRSGRSVTFVT 150 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 33.1 bits (72), Expect = 0.11 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQ 131 E+Y+H+IGR GR A G S +F ++ L++ LQ Sbjct: 410 EEYVHQIGRAGRLGATGWSISFINNASKGLFLQLINKLQ 448 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 32.7 bits (71), Expect = 0.15 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQ 164 E YIHR GRTGR G + +F T + + A++L +L+ Q I +L+ Sbjct: 414 ECYIHRCGRTGRIGHHGIATSFLT-LDCKIAEELKEMLEVMEQPIPKELK 462 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +1 Query: 4 HEALRITFIELVGQEDPKLKELHMHSLPHPTPAKLKISSPFYKKLIR 144 H + +F+ L + +LKE+ + + P P +LK+ F KK+IR Sbjct: 428 HHGIATSFLTLDCKIAEELKEM-LEVMEQPIPKELKMPKQFGKKIIR 473 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 31.9 bits (69), Expect = 0.27 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDL 116 E YIHRIGR+GR KG + F + R +D+ Sbjct: 318 ELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDI 351 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 30.7 bits (66), Expect = 0.61 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 21 YIHRIGRTGRSKAKGTSYAFFTP 89 YIHR GRTGR+ +G F+ P Sbjct: 388 YIHRSGRTGRAGREGICIVFYKP 410 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 30.3 bits (65), Expect = 0.81 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQEANQIISPQLQS 167 E Y+HR GRT R+ +G S P + + + L A+ ++ QL+S Sbjct: 538 EVYVHRSGRTARASHEGLSVVLVGPEDLAHYRKTMKTLNNAS--LNKQLKS 586 >SB_1215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 30.3 bits (65), Expect = 0.81 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQ 131 E Y IGR GR + Y F+ P + ++ L++ +Q Sbjct: 237 ESYYQEIGRAGRDGEPSSCYVFYKPGDFATSRYLINEMQ 275 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +3 Query: 15 EDYIHRIGRTGR-SKAKGTSYAFFTP 89 ++YIHR+GRT R ++ KG + F P Sbjct: 900 KEYIHRVGRTARGTEGKGHALLFLLP 925 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDL 116 +DYIHR+GRT R+ G + + T + + K + Sbjct: 329 KDYIHRVGRTARAGRGGMAISMVTQYDIDRVKKI 362 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNS 98 E Y+HRIGRTGR G + F S Sbjct: 432 ETYLHRIGRTGRFGKSGIAVNFIDGQRS 459 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 15 EDYIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDL 116 E Y+HRIGR GR +G + + +N ++ ++L Sbjct: 296 ETYLHRIGRAGRFGTEGMAVTYV--ANGKEEREL 327 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 28.3 bits (60), Expect = 3.3 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 18 DYIHRIGRTGR 50 DYIHR+GRTGR Sbjct: 779 DYIHRVGRTGR 789 >SB_58021| Best HMM Match : Helicase_C (HMM E-Value=0.017) Length = 91 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 6 RGSEDYIHRIGRTGRSKAKGTSYAFFT 86 + SE Y+HRIGR+GR G + T Sbjct: 22 KNSETYLHRIGRSGRFGHLGVAINLIT 48 >SB_24297| Best HMM Match : Helicase_C (HMM E-Value=0.017) Length = 91 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 6 RGSEDYIHRIGRTGRSKAKGTSYAFFT 86 + SE Y+HRIGR+GR G + T Sbjct: 22 KNSETYLHRIGRSGRFGHLGVAINLIT 48 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 6 RGSEDYIHRIGRTGRSKAKGTSYAFFT 86 + SE Y+HRIGR+GR G + T Sbjct: 370 KNSETYLHRIGRSGRFGHLGVAINLIT 396 >SB_11973| Best HMM Match : Cupin_1 (HMM E-Value=3.4) Length = 394 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/38 (31%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = +1 Query: 7 EALRITFIELVGQEDP-KLKELHMHSLPHPTPAKLKIS 117 E L++ + L GQ+DP +++++ H P+PT +++ I+ Sbjct: 35 ETLKLIYARLTGQQDPNQIRQVISHQ-PNPTTSQVHIT 71 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 6 RGSEDYIHRIGRTGRSKAKGTSYAFFT 86 + SE Y+HRIGR+GR G + T Sbjct: 370 KNSETYLHRIGRSGRFGHLGVAINLIT 396 >SB_37956| Best HMM Match : Helicase_C (HMM E-Value=1.5e-27) Length = 331 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 21 YIHRIGRTGRSKAKGTSYAFFTPSNSRQAKDLVSVLQE 134 ++HR GRT R +G + F P+ D +S+ Q+ Sbjct: 174 FVHRCGRTARIGNEGNAVVFLLPTEDSYV-DFISINQK 210 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 26.6 bits (56), Expect = 10.0 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 21 YIHRIGRTGRSKAKGTSYA 77 ++HR+GR R+ GT+Y+ Sbjct: 559 FVHRVGRVARAGRSGTAYS 577 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,068,110 Number of Sequences: 59808 Number of extensions: 172570 Number of successful extensions: 466 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 466 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 945255773 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -