Samia BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0002_H10
         (118 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_29730| Best HMM Match : No HMM Matches (HMM E-Value=.)              25   9.6  

>SB_29730| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4275

 Score = 25.0 bits (52), Expect = 9.6
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = +2

Query: 5    EAEDEVRNLVKSAGQMLTLETFRRVPPNGIGIRRETC 115
            E +DE++N VK   + +TLE   R+  N +   +  C
Sbjct: 3272 EMKDEIKNCVKKNQKEITLEHALRLVQNVVAPLQNWC 3308


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.313    0.126    0.344 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,463,678
Number of Sequences: 59808
Number of extensions: 35064
Number of successful extensions: 81
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 70
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 81
length of database: 16,821,457
effective HSP length: 19
effective length of database: 15,685,105
effective search space used: 298016995
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)