Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0002_H10
         (118 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    20   2.4  
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          19   5.6  
Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein RJP...    18   9.7  
AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly pro...    18   9.7  
AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly pro...    18   9.7  

>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 20.2 bits (40), Expect = 2.4
 Identities = 8/25 (32%), Positives = 12/25 (48%)
 Frame = +1

Query: 37  ISRSNAYPRNVQESTTERYRYSTRD 111
           I R++ YP    +     YR + RD
Sbjct: 117 IRRNSRYPLRPPQEVISHYRRTRRD 141


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 19.0 bits (37), Expect = 5.6
 Identities = 9/36 (25%), Positives = 18/36 (50%)
 Frame = +1

Query: 4   RGRRRSPEFSEISRSNAYPRNVQESTTERYRYSTRD 111
           RG+   P   EIS+  + P +  +S ++ +  +  D
Sbjct: 611 RGKYEEPTVGEISQDGSSP-HFHQSPSQNHSSAVPD 645


>Z26318-1|CAA81227.1|  544|Apis mellifera royal jelly protein
           RJP57-1 protein.
          Length = 544

 Score = 18.2 bits (35), Expect = 9.7
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -3

Query: 50  FDRLISLNSGL 18
           FDRL  L+SGL
Sbjct: 138 FDRLWVLDSGL 148


>AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly
           protein MRJP6 protein.
          Length = 437

 Score = 18.2 bits (35), Expect = 9.7
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -3

Query: 50  FDRLISLNSGL 18
           FDRL  L+SGL
Sbjct: 136 FDRLWVLDSGL 146


>AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly
           protein MRJP2 protein.
          Length = 452

 Score = 18.2 bits (35), Expect = 9.7
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -3

Query: 50  FDRLISLNSGL 18
           FDRL  L+SGL
Sbjct: 133 FDRLWVLDSGL 143


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.313    0.126    0.344 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 33,510
Number of Sequences: 438
Number of extensions: 526
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 19
effective length of database: 138,021
effective search space used:  2622399
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 35 (18.8 bits)