BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_H07 (294 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U90313-1|AAB70109.1| 241|Homo sapiens glutathione-S-transferase... 60 1e-09 BX537431-1|CAD97673.1| 290|Homo sapiens hypothetical protein pr... 60 1e-09 BC000127-1|AAH00127.1| 241|Homo sapiens glutathione S-transfera... 60 1e-09 AY817669-1|AAV68046.1| 241|Homo sapiens glutathione S-transfera... 60 1e-09 AL139341-5|CAI17224.1| 241|Homo sapiens glutathione S-transfera... 60 1e-09 AF212303-1|AAF73376.1| 241|Homo sapiens glutathione transferase... 60 1e-09 BC056918-1|AAH56918.1| 243|Homo sapiens glutathione S-transfera... 60 2e-09 AY350731-1|AAR02452.1| 243|Homo sapiens glutathione S-transfera... 60 2e-09 AY209189-1|AAP47743.1| 243|Homo sapiens glutathione-S-transfera... 60 2e-09 AY191318-1|AAO23573.1| 241|Homo sapiens glutathione transferase... 60 2e-09 AL162742-1|CAC16040.1| 243|Homo sapiens glutathione S-transfera... 60 2e-09 AL162742-2|CAI12107.1| 215|Homo sapiens glutathione S-transfera... 52 4e-07 AL139341-7|CAI17226.1| 180|Homo sapiens glutathione S-transfera... 52 4e-07 AL139341-6|CAI17225.1| 200|Homo sapiens glutathione S-transfera... 52 4e-07 >U90313-1|AAB70109.1| 241|Homo sapiens glutathione-S-transferase homolog protein. Length = 241 Score = 60.5 bits (140), Expect = 1e-09 Identities = 23/47 (48%), Positives = 36/47 (76%) Frame = +3 Query: 144 PQYSGKLRVFAMRFCPYAERTVLVLNAKNLQYDLVFINLDPEPEWIY 284 P G +R+++MRFCP+AERT LVL AK ++++++ INL +PEW + Sbjct: 18 PVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFF 64 >BX537431-1|CAD97673.1| 290|Homo sapiens hypothetical protein protein. Length = 290 Score = 60.5 bits (140), Expect = 1e-09 Identities = 23/47 (48%), Positives = 36/47 (76%) Frame = +3 Query: 144 PQYSGKLRVFAMRFCPYAERTVLVLNAKNLQYDLVFINLDPEPEWIY 284 P G +R+++MRFCP+AERT LVL AK ++++++ INL +PEW + Sbjct: 67 PVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFF 113 >BC000127-1|AAH00127.1| 241|Homo sapiens glutathione S-transferase omega 1 protein. Length = 241 Score = 60.5 bits (140), Expect = 1e-09 Identities = 23/47 (48%), Positives = 36/47 (76%) Frame = +3 Query: 144 PQYSGKLRVFAMRFCPYAERTVLVLNAKNLQYDLVFINLDPEPEWIY 284 P G +R+++MRFCP+AERT LVL AK ++++++ INL +PEW + Sbjct: 18 PVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFF 64 >AY817669-1|AAV68046.1| 241|Homo sapiens glutathione S-transferase omega 1-1 protein. Length = 241 Score = 60.5 bits (140), Expect = 1e-09 Identities = 23/47 (48%), Positives = 36/47 (76%) Frame = +3 Query: 144 PQYSGKLRVFAMRFCPYAERTVLVLNAKNLQYDLVFINLDPEPEWIY 284 P G +R+++MRFCP+AERT LVL AK ++++++ INL +PEW + Sbjct: 18 PVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFF 64 >AL139341-5|CAI17224.1| 241|Homo sapiens glutathione S-transferase omega 1 protein. Length = 241 Score = 60.5 bits (140), Expect = 1e-09 Identities = 23/47 (48%), Positives = 36/47 (76%) Frame = +3 Query: 144 PQYSGKLRVFAMRFCPYAERTVLVLNAKNLQYDLVFINLDPEPEWIY 284 P G +R+++MRFCP+AERT LVL AK ++++++ INL +PEW + Sbjct: 18 PVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFF 64 >AF212303-1|AAF73376.1| 241|Homo sapiens glutathione transferase omega protein. Length = 241 Score = 60.5 bits (140), Expect = 1e-09 Identities = 23/47 (48%), Positives = 36/47 (76%) Frame = +3 Query: 144 PQYSGKLRVFAMRFCPYAERTVLVLNAKNLQYDLVFINLDPEPEWIY 284 P G +R+++MRFCP+AERT LVL AK ++++++ INL +PEW + Sbjct: 18 PVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFF 64 >BC056918-1|AAH56918.1| 243|Homo sapiens glutathione S-transferase omega 2 protein. Length = 243 Score = 59.7 bits (138), Expect = 2e-09 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = +3 Query: 144 PQYSGKLRVFAMRFCPYAERTVLVLNAKNLQYDLVFINLDPEPEWIY 284 P G +R+++MRFCPY+ RT LVL AK++++++V INL +PEW Y Sbjct: 18 PVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYY 64 >AY350731-1|AAR02452.1| 243|Homo sapiens glutathione S-transferase omega 2 protein. Length = 243 Score = 59.7 bits (138), Expect = 2e-09 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = +3 Query: 144 PQYSGKLRVFAMRFCPYAERTVLVLNAKNLQYDLVFINLDPEPEWIY 284 P G +R+++MRFCPY+ RT LVL AK++++++V INL +PEW Y Sbjct: 18 PVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYY 64 >AY209189-1|AAP47743.1| 243|Homo sapiens glutathione-S-transferase-like protein protein. Length = 243 Score = 59.7 bits (138), Expect = 2e-09 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = +3 Query: 144 PQYSGKLRVFAMRFCPYAERTVLVLNAKNLQYDLVFINLDPEPEWIY 284 P G +R+++MRFCPY+ RT LVL AK++++++V INL +PEW Y Sbjct: 18 PVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYY 64 >AY191318-1|AAO23573.1| 241|Homo sapiens glutathione transferase omega 2 protein. Length = 241 Score = 59.7 bits (138), Expect = 2e-09 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = +3 Query: 144 PQYSGKLRVFAMRFCPYAERTVLVLNAKNLQYDLVFINLDPEPEWIY 284 P G +R+++MRFCPY+ RT LVL AK++++++V INL +PEW Y Sbjct: 16 PVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYY 62 >AL162742-1|CAC16040.1| 243|Homo sapiens glutathione S-transferase omega 2 protein. Length = 243 Score = 59.7 bits (138), Expect = 2e-09 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = +3 Query: 144 PQYSGKLRVFAMRFCPYAERTVLVLNAKNLQYDLVFINLDPEPEWIY 284 P G +R+++MRFCPY+ RT LVL AK++++++V INL +PEW Y Sbjct: 18 PVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYY 64 >AL162742-2|CAI12107.1| 215|Homo sapiens glutathione S-transferase omega 2 protein. Length = 215 Score = 51.6 bits (118), Expect = 4e-07 Identities = 21/36 (58%), Positives = 29/36 (80%) Frame = +3 Query: 177 MRFCPYAERTVLVLNAKNLQYDLVFINLDPEPEWIY 284 MRFCPY+ RT LVL AK++++++V INL +PEW Y Sbjct: 1 MRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYY 36 >AL139341-7|CAI17226.1| 180|Homo sapiens glutathione S-transferase omega 1 protein. Length = 180 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/36 (55%), Positives = 29/36 (80%) Frame = +3 Query: 177 MRFCPYAERTVLVLNAKNLQYDLVFINLDPEPEWIY 284 MRFCP+AERT LVL AK ++++++ INL +PEW + Sbjct: 1 MRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFF 36 >AL139341-6|CAI17225.1| 200|Homo sapiens glutathione S-transferase omega 1 protein. Length = 200 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/36 (55%), Positives = 29/36 (80%) Frame = +3 Query: 177 MRFCPYAERTVLVLNAKNLQYDLVFINLDPEPEWIY 284 MRFCP+AERT LVL AK ++++++ INL +PEW + Sbjct: 1 MRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFF 36 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,527,531 Number of Sequences: 237096 Number of extensions: 885084 Number of successful extensions: 1605 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1605 length of database: 76,859,062 effective HSP length: 74 effective length of database: 59,313,958 effective search space used: 1364221034 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -