BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_H04 (517 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 24 0.92 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 22 3.7 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 21 4.9 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 8.6 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.8 bits (49), Expect = 0.92 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 211 SYHHEAVGYSASGCKNFG 264 S+HH+A GY G +N+G Sbjct: 190 SFHHDAAGY---GLRNYG 204 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.8 bits (44), Expect = 3.7 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = +2 Query: 230 LDIVHPAAKTLVDIAKSQDAEVGDGTTSVVILAGELLKRLRPFVEVGVHPRV 385 L IV AA + S+ V G S ++ + +RP V G PRV Sbjct: 61 LKIVEMAANGIRPCVISRQLRVSHGCVSKILNRYQETGSIRPGVIGGSKPRV 112 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 21.4 bits (43), Expect = 4.9 Identities = 9/44 (20%), Positives = 22/44 (50%) Frame = -3 Query: 365 LQQTASISSEVHQLRLQPM*YHHRPQRPEIWQCRPKFLQPDALY 234 L+ + ++ H+ ++ + ++ Q+PE W+ K P +Y Sbjct: 66 LKNECAKCNDKHKEGIRKVIHYLVKQKPEWWEQLQKKFDPQGIY 109 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 20.6 bits (41), Expect = 8.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 415 LSSGTDGSNDNSRMDPYFNKRPQS 344 LS+ T + N+R PY +RP+S Sbjct: 252 LSTCTRTTLKNNRASPYPMQRPKS 275 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,809 Number of Sequences: 336 Number of extensions: 2343 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -