BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_H03 (302 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC806.07 |ndk1||nucleoside diphosphate kinase|Schizosaccharomy... 75 2e-15 SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces pomb... 27 0.80 >SPAC806.07 |ndk1||nucleoside diphosphate kinase|Schizosaccharomyces pombe|chr 1|||Manual Length = 151 Score = 75.4 bits (177), Expect = 2e-15 Identities = 31/57 (54%), Positives = 45/57 (78%) Frame = +3 Query: 126 ERTFLMVKPDGVQRGLVGTIIERFEKKGFKLVGLKFVWPSEELLQQHYSDLASRPFF 296 E+TF+ VKPD VQRGL+G II +FE KG+KL LKF+ PS +L+++HY++ +PF+ Sbjct: 4 EQTFIAVKPDAVQRGLIGYIISKFELKGYKLRALKFLVPSRDLVEEHYAEHKGKPFY 60 >SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces pombe|chr 2|||Manual Length = 662 Score = 26.6 bits (56), Expect = 0.80 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 211 KPFFSKRSMIVPTRPR*TPSGLT 143 KPF +KRS ++P RP T L+ Sbjct: 512 KPFVNKRSKVLPLRPSVTHDNLS 534 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,113,098 Number of Sequences: 5004 Number of extensions: 18032 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 75747362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -