BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_H01 (381 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25G10.06 |rps2801|rps28-1|40S ribosomal protein S28|Schizosa... 71 5e-14 SPCC285.15c |rps2802|rps28-2, rps28|40S ribosomal protein S28|Sc... 71 5e-14 SPCC1795.10c |||Sed5 Vesicle Protein Svp26 |Schizosaccharomyces ... 25 5.3 SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pomb... 24 7.0 SPAC1142.01 ||SPAC17G6.18|DUF654 family protein|Schizosaccharomy... 24 7.0 SPCC777.15 |||tRNA dihydrouridine synthase Dus4 |Schizosaccharom... 24 9.3 SPAC17A5.16 |||human down-regulated in multiple cancers-1 homolo... 24 9.3 >SPAC25G10.06 |rps2801|rps28-1|40S ribosomal protein S28|Schizosaccharomyces pombe|chr 1|||Manual Length = 68 Score = 71.3 bits (167), Expect = 5e-14 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +2 Query: 47 PNVLARVVKVLGRTGSQXQCTQVKVEFIGETSRQIIRNVKGPVRDGDIL 193 P LA+V+KVLGRTGS+ TQV+VEF+ +TSR IIRNVKGPVR+ DIL Sbjct: 7 PVKLAKVIKVLGRTGSRGGVTQVRVEFMDDTSRSIIRNVKGPVREDDIL 55 >SPCC285.15c |rps2802|rps28-2, rps28|40S ribosomal protein S28|Schizosaccharomyces pombe|chr 3|||Manual Length = 68 Score = 71.3 bits (167), Expect = 5e-14 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +2 Query: 47 PNVLARVVKVLGRTGSQXQCTQVKVEFIGETSRQIIRNVKGPVRDGDIL 193 P LA+V+KVLGRTGS+ TQV+VEF+ +TSR IIRNVKGPVR+ DIL Sbjct: 7 PVKLAKVIKVLGRTGSRGGVTQVRVEFMDDTSRSIIRNVKGPVREDDIL 55 >SPCC1795.10c |||Sed5 Vesicle Protein Svp26 |Schizosaccharomyces pombe|chr 3|||Manual Length = 227 Score = 24.6 bits (51), Expect = 5.3 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 360 RIIYILRAEYRDIVIFDGFILMLTHKFG*LVHY 262 R++Y + A +VIFDGF L+ F HY Sbjct: 47 RLVYFIMAVMVFLVIFDGFPFWLS-AFSIFSHY 78 >SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pombe|chr 2|||Manual Length = 1018 Score = 24.2 bits (50), Expect = 7.0 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = -3 Query: 238 PLSKSPGFTLRLEKGQ--DVSVADRSLHVPDDLTASLSDELHFDLSTLXL*SGAAEHFHD 65 P+S PG + ++ + + D S+ ++LTAS +E H++L T + + Sbjct: 391 PVSSQPGSDAKSQEFDFFEAKIPD-SIAKLNELTAS--NENHYELKTYDRAERLRQKIQE 447 Query: 64 TSKNVRLI 41 S N RLI Sbjct: 448 VSSNKRLI 455 >SPAC1142.01 ||SPAC17G6.18|DUF654 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 667 Score = 24.2 bits (50), Expect = 7.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 93 DPVRPSTFTTRARTLGLSIXNYISSF 16 DP+ P T+ + ++ G I I+SF Sbjct: 560 DPLPPDTYLSESQVFGRDISRRIASF 585 >SPCC777.15 |||tRNA dihydrouridine synthase Dus4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 326 Score = 23.8 bits (49), Expect = 9.3 Identities = 8/36 (22%), Positives = 21/36 (58%) Frame = +2 Query: 38 MDKPNVLARVVKVLGRTGSQXQCTQVKVEFIGETSR 145 +D+P + ++V+ + T + CT+VK+ + ++ Sbjct: 123 LDEPEKVHKLVRAVKSTLGESFCTEVKIRIAKDLNK 158 >SPAC17A5.16 |||human down-regulated in multiple cancers-1 homolog 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 925 Score = 23.8 bits (49), Expect = 9.3 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 244 IGPLSKSPGFTLRLEKGQDVSVADRSL 164 + P+S P ++ L+ DVS AD S+ Sbjct: 168 LSPVSTFPASSISLDASSDVSAADVSV 194 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,399,893 Number of Sequences: 5004 Number of extensions: 23816 Number of successful extensions: 56 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 124270298 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -