BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_G19 (395 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 21 3.4 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 21 3.4 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 21.4 bits (43), Expect = 3.4 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 292 VMRVLAVTTRPGPVSVRIQNCPTYLTQLEGLL 387 + R +VT P + Q C T L + EG+L Sbjct: 340 IERADSVTWNPHKLLTAPQQCSTLLLRHEGVL 371 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.4 bits (43), Expect = 3.4 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +1 Query: 286 LEVMRVLAVTTRPGPVSVRIQNCPTYLTQLEG 381 L+V+ V+ V QN P Y + L+G Sbjct: 193 LDVINVMTYDFHGSWAGVTAQNSPLYASPLDG 224 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,532 Number of Sequences: 336 Number of extensions: 1389 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8435920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -