BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_G19 (395 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1514 - 37892552-37893074,37893291-37893367,37893471-378935... 28 2.4 08_01_0050 + 350768-351214,352597-352717,352944-353118,353225-35... 28 3.1 08_02_1138 + 24631919-24632248,24634100-24634502,24634788-246349... 27 5.5 >01_06_1514 - 37892552-37893074,37893291-37893367,37893471-37893587, 37893826-37893926,37895077-37895146,37895318-37895415, 37896326-37896419,37896792-37896882,37897222-37897547, 37898193-37898278,37899078-37899417 Length = 640 Score = 28.3 bits (60), Expect = 2.4 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +3 Query: 219 KQPLRAPVRRGHTIAVS 269 K P+R+P +RGHTI +S Sbjct: 523 KSPVRSPTQRGHTITLS 539 >08_01_0050 + 350768-351214,352597-352717,352944-353118,353225-353295, 353575-354209 Length = 482 Score = 27.9 bits (59), Expect = 3.1 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -1 Query: 341 RTDTGPGRVVTASTRITSRSFLYIRYSYSMTSAHRGSQW 225 R + PGR VT S +TSR L++ + + + +W Sbjct: 116 RLEVPPGRWVTGSFNLTSRFTLFLHHGAIILGSQDPEEW 154 >08_02_1138 + 24631919-24632248,24634100-24634502,24634788-24634982, 24635384-24635838,24636119-24636349,24636891-24637123, 24637899-24637971 Length = 639 Score = 27.1 bits (57), Expect = 5.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 317 LARGQCLFGFRTALHILHSW 376 LA G C+ F +HI+H W Sbjct: 98 LATGICVAAFNRGVHIIHEW 117 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,511,492 Number of Sequences: 37544 Number of extensions: 128536 Number of successful extensions: 223 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 223 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 684860244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -