BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_G19 (395 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 28 2.6 At1g55620.2 68414.m06367 voltage-gated chloride channel family p... 28 2.6 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 27.9 bits (59), Expect = 2.6 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 132 GRKNNPYKIKNYRVIFLIMGSEQSSAAAKKQPLRAPVRR 248 GR +P IK + + G +SS +++ Q R+PVRR Sbjct: 545 GRHTSPSHIKQDGSMSPVRGRGKSSPSSRHQKARSPVRR 583 >At1g55620.2 68414.m06367 voltage-gated chloride channel family protein contains Pfam profiles PF00654: Voltage gated chloride channel, PF00571: CBS domain Length = 781 Score = 27.9 bits (59), Expect = 2.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 317 LARGQCLFGFRTALHILHSW 376 +A G C+ GF +H++H W Sbjct: 140 VAAGICVAGFNKGVHVIHEW 159 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,946,278 Number of Sequences: 28952 Number of extensions: 106119 Number of successful extensions: 166 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 166 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 565902384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -