BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_G18 (457 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 25 1.7 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 24 2.9 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 23 6.7 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 22 8.9 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 24.6 bits (51), Expect = 1.7 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +2 Query: 290 CSCSGCVRSTTACSFVSTRPQ*TCFVSLSPILHGAT 397 C C G TRP +CFVS+ +L T Sbjct: 74 CYCEGHCPGNLQNGTCETRPGGSCFVSVEAVLDEET 109 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 23.8 bits (49), Expect = 2.9 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 109 EIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAK 228 E+F+++ Q +E+ I D I L QAR Y P E++ Sbjct: 255 EMFRQSVQEREEHGIVRPDLIHLLIQARKGQLRYQPQESE 294 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 22.6 bits (46), Expect = 6.7 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = -1 Query: 292 AIPCVPWVILG 260 A+ C+PW++LG Sbjct: 649 ALLCIPWMLLG 659 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 22.2 bits (45), Expect = 8.9 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = -2 Query: 450 QFGETAFVHQLSDTLQVGVAPCNIGLSD 367 +F + + H +++ Q GVA C + D Sbjct: 955 KFRKPFYKHSIAENSQYGVAVCTVVAED 982 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 468,879 Number of Sequences: 2352 Number of extensions: 8805 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39119412 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -