BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_G14 (529 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 24 2.7 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 2.7 AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 24 3.6 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 24 3.6 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 23 4.8 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 6.3 AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-tran... 23 6.3 AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-tran... 23 6.3 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.4 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 8.4 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 8.4 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 8.4 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 8.4 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 24.2 bits (50), Expect = 2.7 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 85 VASSDGPTRNSKKPTWVRDGRRTPSVVHL 171 + + G ++NS P +GRRTP+ + L Sbjct: 173 IPQASGHSKNSLSPGGTDNGRRTPTWLDL 201 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.2 bits (50), Expect = 2.7 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 87 DDDSRACAPCEYPEVYPLR 31 +D+SRA EY ++ PLR Sbjct: 194 EDESRALCTSEYSDISPLR 212 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 79 IIVASSDGPTRNSKKPTWVRDGRRTP 156 + + DG T + PT VRDG P Sbjct: 74 VTICCPDGVTTVDRNPTAVRDGLPNP 99 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.8 bits (49), Expect = 3.6 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = +2 Query: 53 YSHGAQARESSSRAAMGRQGIQKSPHGYEMEGEPLRWCISC*GHRPRKSWR 205 YS R S +++ GIQ H ++++ + R+ HR + WR Sbjct: 195 YSDHRYVRFSVDSSSVLGNGIQLHRHQHQLQPQQRRFHRQSPAHRRKPRWR 245 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.4 bits (48), Expect = 4.8 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +2 Query: 98 MGRQGIQKSPHGYEMEGEPLRWC 166 MG I +SP G +M WC Sbjct: 83 MGVMPIMRSPKGVDMPRTTFTWC 105 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.0 bits (47), Expect = 6.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 126 HMGTRWKANPFGGASHAKGI 185 H G RWKA+ F +S + + Sbjct: 283 HAGRRWKASQFSPSSFLEAL 302 >AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-transferase 3-8 protein. Length = 225 Score = 23.0 bits (47), Expect = 6.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 Query: 238 LRMAEFGCLASTPTFSRTMPLA*DAPPKGFAF 143 L +A+F C++S T +PL PK A+ Sbjct: 157 LTIADFSCISSIATLVGVVPLDESKFPKSTAW 188 >AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-transferase E7 protein. Length = 225 Score = 23.0 bits (47), Expect = 6.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 Query: 238 LRMAEFGCLASTPTFSRTMPLA*DAPPKGFAF 143 L +A+F C++S T +PL PK A+ Sbjct: 157 LTIADFSCISSIATLVGVVPLDESKFPKSTAW 188 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 8.4 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 4/52 (7%) Frame = -1 Query: 364 WPLRPNPATNTSSFSSMW-LRQPSR---GTNAVTFLPLLMSCTRTHLRMAEF 221 WPL + + T +F+S W L Q G + F L+ + T L F Sbjct: 558 WPLCGSASRQTQTFTSQWYLNQEDNTDTGLRILYFYDLIKNKTDIRLTSINF 609 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +1 Query: 229 PFVSVFVYSSLITA 270 PF+ +F++SSLI A Sbjct: 367 PFLHIFLFSSLIAA 380 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 8.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 501 RQRVTHLSQCKPMTWASPSFLCTEL 427 RQR T TW S S LC EL Sbjct: 91 RQRATRAPTTS--TWTSKSVLCEEL 113 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 22.6 bits (46), Expect = 8.4 Identities = 19/77 (24%), Positives = 33/77 (42%) Frame = -1 Query: 454 LSFFSLYRARSDTFATLTTLNLTPGMSPTAWPLRPNPATNTSSFSSMWLRQPSRGTNAVT 275 LS S + + S T + ++ TP +S + + P A + + + +QPS Sbjct: 1338 LSQSSHHSSSSHGGPTPSIISHTPSLSSASGSIGPKSADQPGAAAGLHHQQPSSPPTQTI 1397 Query: 274 FLPLLMSCTRTHLRMAE 224 +PL S T T +E Sbjct: 1398 GIPL--SPTETEATSSE 1412 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 22.6 bits (46), Expect = 8.4 Identities = 11/55 (20%), Positives = 19/55 (34%) Frame = +3 Query: 87 REQRWADKEFKKAHMGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRV 251 R R + + + GTRWK + F K + + + S + V Sbjct: 228 RAARRGQRPARVSKAGTRWKTSQFDSQLFGKALAMTGFARQVNSVESLVESLTSV 282 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 608,152 Number of Sequences: 2352 Number of extensions: 13065 Number of successful extensions: 24 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -