BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_G09 (494 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 23 1.1 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 23 2.0 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 3.5 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 21 4.6 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 21 4.6 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 21 6.1 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 21 6.1 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 23.4 bits (48), Expect = 1.1 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = -1 Query: 173 VFAVSFANNFLFFRYFI*HFNQKISKIKRSI*RYFPRPKRSSPFFTKT*HIRMSPS 6 +F++S A N F H I + R P PKRSSP + + +SP+ Sbjct: 47 LFSLSLAQNNQLFT----HHKAPIRPVALPPKREIPSPKRSSPILAE--KVSVSPT 96 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 22.6 bits (46), Expect = 2.0 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -1 Query: 425 VVQWSSNCGPHVALERYLCGPRRIKQFW*TMTQN 324 ++ W+S+ +E+YL R + Q W + N Sbjct: 434 IILWTSHLTQADVIEKYLSKARYVIQTWVPASDN 467 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.8 bits (44), Expect = 3.5 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -1 Query: 428 IVVQWSSNCGPHVALERYLCGPRRIKQFW 342 +V+ WSSN + +YL + Q W Sbjct: 451 LVIIWSSNLSKRPYIYKYLDKKNVVVQSW 479 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 21.4 bits (43), Expect = 4.6 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -1 Query: 380 RYLCGPRRIKQFW-*TMTQNRVYIRLVNQVVK 288 +YLC PRRI+ +T+ ++ I N+ +K Sbjct: 108 KYLCRPRRIQMAQNLNLTERQIKIWFQNRRMK 139 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 21.4 bits (43), Expect = 4.6 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -1 Query: 380 RYLCGPRRIKQFW-*TMTQNRVYIRLVNQVVK 288 +YLC PRRI+ +T+ ++ I N+ +K Sbjct: 128 KYLCRPRRIQMAQNLNLTERQIKIWFQNRRMK 159 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.0 bits (42), Expect = 6.1 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -1 Query: 380 RYLCGPRRIK 351 +YLC PRRI+ Sbjct: 27 KYLCRPRRIE 36 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 21.0 bits (42), Expect = 6.1 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -1 Query: 380 RYLCGPRRIK 351 +YLC PRRI+ Sbjct: 158 KYLCRPRRIE 167 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,227 Number of Sequences: 336 Number of extensions: 2500 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11630247 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -