BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_G08 (517 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 25 5.1 SPBC119.17 ||SPBC577.01|metallopeptidase|Schizosaccharomyces pom... 25 5.1 SPAC1002.21 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 6.7 SPAC23H3.02c |ini1||RING finger-like protein Ini1|Schizosaccharo... 25 6.7 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 25 6.7 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 25.4 bits (53), Expect = 5.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 76 SPYAY*TSGSSQLLPFCSTRGF 11 SPYA+ T S+ L PF STR + Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSY 1232 >SPBC119.17 ||SPBC577.01|metallopeptidase|Schizosaccharomyces pombe|chr 2|||Manual Length = 992 Score = 25.4 bits (53), Expect = 5.1 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +3 Query: 336 CDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLCLNA--SKAEASLAESG 485 CD+ + S G L H + R GG + + + N+ SK E +A SG Sbjct: 601 CDACLNLGTHSESIGDLEHQIRRYTGGISISPSAVTNNSDVSKYELGIAISG 652 >SPAC1002.21 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 148 Score = 25.0 bits (52), Expect = 6.7 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +3 Query: 336 CDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLCLNASK 458 C A + +S G +VHA RAA + A CL K Sbjct: 54 CLHRCAFLDLTKSRGRVVHACSRAALPRAIADASHCLEEKK 94 >SPAC23H3.02c |ini1||RING finger-like protein Ini1|Schizosaccharomyces pombe|chr 1|||Manual Length = 117 Score = 25.0 bits (52), Expect = 6.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 387 PNVRNCGSSRTEQYYYRNDEPSVG 316 P V N GSSRT+ +Y R + G Sbjct: 86 PRVINLGSSRTDWFYERKKFKNAG 109 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 25.0 bits (52), Expect = 6.7 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 140 NFSGTSC*KLFILKDR*AVLSQSL 69 N G S KLFI+KD V+SQ L Sbjct: 3491 NIGGRSPQKLFIVKDSGQVMSQDL 3514 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,121,056 Number of Sequences: 5004 Number of extensions: 40349 Number of successful extensions: 84 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -