BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_G05 (480 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.9 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 22 2.6 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 21 4.5 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 4.5 AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 21 4.5 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 5.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 1.9 Identities = 11/43 (25%), Positives = 18/43 (41%) Frame = +1 Query: 10 EYPKCFIVGADNVGSQQMQQIRISLRGHSIVLMGKNTMMRKAI 138 EYPKC+ V + + +R S KN ++ A+ Sbjct: 2443 EYPKCWQVDCNKGPDSDKEAFAAFVRELSAAFKPKNLLLSAAV 2485 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 22.2 bits (45), Expect = 2.6 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +3 Query: 6 RRIPKMFHSGCGQC 47 + +P HSGC +C Sbjct: 65 KALPDALHSGCSKC 78 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.4 bits (43), Expect = 4.5 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +3 Query: 15 PKMFHSGCGQCRLATDATDPYFIAWSQ 95 P +FH G + L + P + W Q Sbjct: 357 PPLFHMGGDEVHLGCWNSTPSIVQWMQ 383 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 4.5 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +2 Query: 251 WRTKSKPRLVLEPLLHCLS 307 W T P V+ P ++C S Sbjct: 307 WSTVQTPTTVMSPTINCWS 325 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 271 GLGLCSPTVYHAHQQDLH 218 GL L T+ H H DLH Sbjct: 95 GLKLPKSTITHLHIYDLH 112 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.0 bits (42), Expect = 5.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 103 LMGKNTMMRKAIKDHLETNP 162 L +TM A K HLE NP Sbjct: 608 LRDTSTMGYMAAKKHLEINP 627 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,638 Number of Sequences: 336 Number of extensions: 2682 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -