BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_G05 (480 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. 26 0.58 AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. 26 0.58 AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. 26 0.58 AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. 26 0.58 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 25 1.0 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 25 1.0 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 25 1.0 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 25 1.0 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 25 1.0 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 25 1.0 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 25 1.0 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 25 1.0 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 25 1.0 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 25 1.0 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 25 1.0 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 25 1.0 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 25 1.0 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 25 1.0 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 25 1.0 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 25 1.0 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 25 1.0 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 25 1.0 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 25 1.0 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 1.8 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 24 2.4 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 24 2.4 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 24 2.4 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 24 3.1 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 24 3.1 AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. 24 3.1 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 23 4.1 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 4.1 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 23 4.1 AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 23 5.4 AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-b... 23 7.2 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 22 9.5 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 22 9.5 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 22 9.5 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 22 9.5 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 22 9.5 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 22 9.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 22 9.5 AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 22 9.5 >AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 26.2 bits (55), Expect = 0.58 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 330 ASVMSGNDDRQWSNGSRTSRGLDFVLQQFITHINKIST 217 +S+ S DD SN S TS G + + F+ NK+++ Sbjct: 98 SSIASSGDDTNSSNNSTTSNGTEDRHECFVFISNKLAS 135 >AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 26.2 bits (55), Expect = 0.58 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 330 ASVMSGNDDRQWSNGSRTSRGLDFVLQQFITHINKIST 217 +S+ S DD SN S TS G + + F+ NK+++ Sbjct: 98 SSIASSGDDTNSSNNSTTSNGTEDRHECFVFISNKLAS 135 >AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 26.2 bits (55), Expect = 0.58 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 330 ASVMSGNDDRQWSNGSRTSRGLDFVLQQFITHINKIST 217 +S+ S DD SN S TS G + + F+ NK+++ Sbjct: 98 SSIASSGDDTNSSNNSTTSNGTEDRHECFVFISNKLAS 135 >AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 26.2 bits (55), Expect = 0.58 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 330 ASVMSGNDDRQWSNGSRTSRGLDFVLQQFITHINKIST 217 +S+ S DD SN S TS G + + F+ NK+++ Sbjct: 98 SSIASSGDDTNSSNNSTTSNGTEDRHECFVFISNKLAS 135 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELPHATEEQSPLQL 433 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 25.4 bits (53), Expect = 1.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQSPLQL 433 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 24.6 bits (51), Expect = 1.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 11 NTQNVS*WVRTM*ARNRCNRSVFHCVVTALC 103 NT + W+ + ARN R+VF+CV C Sbjct: 1371 NTMQLRFWI--VGARNVAKRTVFNCVKCTRC 1399 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 24.2 bits (50), Expect = 2.4 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGLIELQHATEEQSPLQL 433 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 24.2 bits (50), Expect = 2.4 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGLIELQHATEEQSPLQL 433 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 2.4 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKANISL 190 D Q SNG R LD LQQ + I E+++ + L Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGLIELQHATEEQSPLQL 433 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 23.8 bits (49), Expect = 3.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKA 202 D Q SNG R LD LQQ + I E+++ Sbjct: 380 DEQVSNGRRAHAELDGTLQQAVGQIELPHATEEQS 414 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 3.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHINKISTGEDKA 202 D Q SNG R LD LQQ + I E+++ Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQS 429 >AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 3.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 330 ASVMSGNDDRQWSNGSRTSRGLDFVLQQFITHINKIST 217 +S+ S DD SN TS G + + F+ NK+++ Sbjct: 98 SSIASSGDDTNSSNNLTTSNGTEDRHECFVFISNKLAS 135 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 23.4 bits (48), Expect = 4.1 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 306 DRQWSNGSRTSRGLDFVLQQFITHI 232 D Q SNG R LD LQQ + I Sbjct: 395 DEQVSNGRRAHAELDGTLQQAVGQI 419 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 4.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 105 HGQKHHDEESHQGPS*NKSSSRKTASS 185 H +HH +H GPS SS+R++ + Sbjct: 659 HHAQHHSNGTHHGPS-LMSSARESCGA 684 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 23.4 bits (48), Expect = 4.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 381 LSGDGKSLEERSLLRTKASVMSGNDDRQ 298 +SGDG S+ +RS G+DD + Sbjct: 63 VSGDGSSVHDRSRSERFGPPYDGDDDEE 90 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 23.0 bits (47), Expect = 5.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 106 MGKNTMMRKAIKDHLETNPALEKLLPHIKGNVGFV 210 M +NT ++ A+ HL NP ++ L +K V V Sbjct: 102 MFQNTTLQ-AVLSHLRNNPITDEHLAKVKRGVEIV 135 >AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-binding protein OBPjj4 protein. Length = 204 Score = 22.6 bits (46), Expect = 7.2 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 127 RKAIKDHLETNPALEKLL 180 RKAI+ ++ NPA KLL Sbjct: 104 RKAIEPVVKANPAFAKLL 121 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 22.2 bits (45), Expect = 9.5 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Frame = -2 Query: 245 LSRTSTRSPRVKTKPTFPLM*GSSF-----SRAGFVSRWSLMAFLIMVFLPMSTML 93 + T +PR+ PTFP + SF SRA F ++A L++ F P S ++ Sbjct: 547 MKEAPTTNPRIVPIPTFPQIRKLSFVPKMKSRACFGYVGPIIAALVL-FRPASCVV 601 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.2 bits (45), Expect = 9.5 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +1 Query: 310 IPAHNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHI 423 +PA T TS A S PT+ + I+ +HI Sbjct: 39 VPACTTTTSTTSTSGASAASSPTRDEMSVVVPISPLHI 76 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.2 bits (45), Expect = 9.5 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +1 Query: 310 IPAHNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHI 423 +PA T TS A S PT+ + I+ +HI Sbjct: 39 VPACTTTTSTTSTSGASAASSPTRDEMSVVVPISPLHI 76 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 22.2 bits (45), Expect = 9.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 376 WGWKEPGRKKSSQDQ 332 WG + PG ++S+DQ Sbjct: 332 WGKRPPGEAENSRDQ 346 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 22.2 bits (45), Expect = 9.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 181 PHIKGNVGFVFTRGD 225 P +KGNVG+ +GD Sbjct: 734 PGLKGNVGYSGDKGD 748 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 22.2 bits (45), Expect = 9.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 99 CAHGQKHHDEESHQGPS*NKSSSRKTASSHQG 194 C++G SH S + SSS +A S G Sbjct: 1085 CSNGSCSSTSSSHSNHSSHSSSSSNSAGSWAG 1116 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 22.2 bits (45), Expect = 9.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 117 HHDEESHQGPS*NKSSSRKTASSHQG 194 HH SH GP+ + S + SS G Sbjct: 1343 HHSSSSHGGPTPSIISHTPSLSSASG 1368 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 22.2 bits (45), Expect = 9.5 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +3 Query: 51 LATDATDPYFIAWSQH 98 L T DP F W QH Sbjct: 392 LTTTMRDPLFYRWHQH 407 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 530,425 Number of Sequences: 2352 Number of extensions: 11273 Number of successful extensions: 55 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 41863041 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -