BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_G05 (480 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 25 0.42 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 0.97 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 1.7 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 3.0 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 6.9 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 6.9 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 6.9 DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 21 9.1 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 25.0 bits (52), Expect = 0.42 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +3 Query: 126 EESHQGPS*NKSSSRKTASSHQGKC---WLCLHPWR 224 + QGP + + + + S H C W+C H WR Sbjct: 350 QSKDQGPPNDGNGNILSPSIHDNICSNGWICEHRWR 385 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 0.97 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 99 CAHGQKHHDEESHQGPS*NKSSSRKTASS 185 C G+ HD++ P + SSS ++A S Sbjct: 430 CLDGKLPHDDQPPLSPQSDSSSSSRSAES 458 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 1.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 357 EERSLLRTKASVMSGNDDRQW 295 E R LRT A++++ N+ R W Sbjct: 1177 ELRPYLRTAAAILTWNEKRFW 1197 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +3 Query: 351 FLPGSFHPH 377 FLP S+HPH Sbjct: 311 FLPPSYHPH 319 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.0 bits (42), Expect = 6.9 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 Query: 359 WKKEVFSGPRPVL*AGMTTD 300 WK GP+PV G T D Sbjct: 29 WKSRGVVGPKPVPFFGTTKD 48 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.0 bits (42), Expect = 6.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 397 IEIINDVHILKPGDKVGASEATLLN 471 I I+N HIL+ K G S L+N Sbjct: 480 IGIVNQFHILQFITKNGTSNNYLIN 504 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.0 bits (42), Expect = 6.9 Identities = 10/45 (22%), Positives = 23/45 (51%) Frame = +1 Query: 49 GSQQMQQIRISLRGHSIVLMGKNTMMRKAIKDHLETNPALEKLLP 183 G+QQ +++++L + MRK ++ T+ L +++P Sbjct: 356 GTQQSVELKLALDQEQLKSKKLEESMRKLDEEMKRTDELLYQMIP 400 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 20.6 bits (41), Expect = 9.1 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -1 Query: 246 FITHINKISTGEDKANISLDVRKQFFESWICFKMVLDG 133 FI I I +A+I D RK+ SW K + G Sbjct: 9 FILVITLIFLYFGEADIKKDCRKESKVSWAALKKMKAG 46 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,554 Number of Sequences: 438 Number of extensions: 3058 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13051674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -