BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_G04 (497 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.33 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 1.3 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 22 3.1 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 22 3.1 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 22 3.1 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 25.4 bits (53), Expect = 0.33 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 360 GPLPSQQNKPQTTQSPRTTKPPNYTQG 440 GP PS PQ +P+ PPN +QG Sbjct: 22 GPQPSPHQSPQ---APQRGSPPNPSQG 45 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 1.3 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 332 KTTLRLPEETDDATLKRSLIKSR*KFRATVQRDTI-ASRAQLVSH 201 K L+ P D +L K KFRA Q+D+ A A +V H Sbjct: 622 KRVLQAPPLYDTNSLMDEAYKPHKKFRALRQKDSAEAEPAVIVQH 666 Score = 22.6 bits (46), Expect = 2.3 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 399 QSPRTTKPPNYTQGGEDPVYDEDSLPAPSSQC 494 Q RT NY GE ++ P+P+ QC Sbjct: 720 QLKRTDIIHNYIMRGEASPRSPNASPSPAEQC 751 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 250 QLYSETQLLVAPSWCHTCLCKNMTP 176 Q+Y + L+V SW L +N TP Sbjct: 226 QIYIPSGLIVIISWVSFWLNRNATP 250 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 250 QLYSETQLLVAPSWCHTCLCKNMTP 176 Q+Y + L+V SW L +N TP Sbjct: 226 QIYIPSGLIVIISWVSFWLNRNATP 250 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 250 QLYSETQLLVAPSWCHTCLCKNMTP 176 Q+Y + L+V SW L +N TP Sbjct: 165 QIYIPSGLIVIISWVSFWLNRNATP 189 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,061 Number of Sequences: 438 Number of extensions: 2545 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -