BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_G03 (357 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 0.54 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 1.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 1.2 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 1.6 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 20 8.7 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.8 bits (49), Expect = 0.54 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -1 Query: 204 WYLFTLLQKCG*INY*TAFLLR*ICISFRYCFQIFSLC 91 +Y LL C I + T LL +CI + YC I LC Sbjct: 261 FYYMHLLFCCAFIIF-TMHLLFLLCIYYFYCALIILLC 297 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.6 bits (46), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%), Gaps = 1/15 (6%) Frame = +2 Query: 311 QWNQWRKPRRP-EQL 352 Q NQW KP RP EQL Sbjct: 582 QQNQWCKPCRPREQL 596 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.6 bits (46), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%), Gaps = 1/15 (6%) Frame = +2 Query: 311 QWNQWRKPRRP-EQL 352 Q NQW KP RP EQL Sbjct: 474 QQNQWCKPCRPREQL 488 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 22.2 bits (45), Expect = 1.6 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -3 Query: 109 PNFQPLQSMPLKPLEYILVFLHSSSKSSIPQHQDLV 2 P P+ S+P P + + ++ SI QH L+ Sbjct: 477 PQLSPMSSLPPYPNRTQITEVTQQTEPSIYQHDQLL 512 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 19.8 bits (39), Expect = 8.7 Identities = 7/25 (28%), Positives = 12/25 (48%) Frame = -1 Query: 126 SFRYCFQIFSLCNRCH*SR*NIFWC 52 S + F LC+ C+ + + WC Sbjct: 305 SVPFIFDSIHLCDVCYSTIGTVSWC 329 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.308 0.125 0.325 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,057 Number of Sequences: 336 Number of extensions: 1685 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7193380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.3 bits)
- SilkBase 1999-2023 -